KEGG   Alpha proteobacterium HIMB59: HIMB59_00012360Help
Entry
HIMB59_00012360   CDS       T02249                                 

Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB59_00012360
   01230 Biosynthesis of amino acids
    HIMB59_00012360
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB59_00012360
   00051 Fructose and mannose metabolism
    HIMB59_00012360
   00562 Inositol phosphate metabolism
    HIMB59_00012360
Enzymes [BR:apc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HIMB59_00012360
Exosome [BR:apc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HIMB59_00012360
  Exosomal proteins of bladder cancer cells
   HIMB59_00012360
  Exosomal proteins of melanoma cells
   HIMB59_00012360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1126762..1127472)
Genome map
AA seq 236 aa AA seqDB search
MKYIIFNWKSYLNLKESVKLSNIISGFKKSKKFKIISAPNNFFHLALSEKFKKNLYATQN
FDLDGRGASTGSLDISHLIENKIKYTIIGHSEMRSNHGENDKIVSKKLELSINNKLIPIV
CIGESLNIYKSKKTKPYLRSQINTIFKKTAKYDQIILAYEPLWSIGTGLTPELSEIEDIC
KFLSKILEKYTFKKINILYGGSVNLSNISEILNLQFVNGVLVGSASTKSSFIKYFK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatataatatttaattggaaatcatatttaaatcttaaagagtctgtaaagctt
tcaaatattatttcaggatttaaaaagagcaaaaaatttaaaataatatctgctccaaat
aatttttttcatttagcattatcagaaaaatttaaaaaaaacttatatgcaactcaaaat
tttgatttggatggaaggggagctagcactggctcattagatatttcccatctcatagaa
aataaaattaaatatacaataattggtcattcagaaatgagatctaatcatggtgaaaat
gataaaattgtaagtaagaagttagagttatctattaataataagttgatcccgatagtt
tgtatcggcgagtctttaaatatttataaatctaaaaaaactaaaccgtatcttcgtagt
caaattaacactatttttaaaaaaaccgcgaagtacgaccaaattatcttagcatatgaa
cctttatggtctattggcactggattaacaccagaattatcagaaattgaagatatttgt
aaatttttaagtaaaattcttgaaaaatatacttttaaaaaaattaatattttatatggt
ggttcggtaaatttaagtaatatttcggaaatcttaaatttacaatttgttaacggcgtt
ttagttggatcagcctcaactaaatcttcgtttattaaatattttaaataa

DBGET integrated database retrieval system