KEGG   Alpha proteobacterium HIMB59: HIMB59_00012410Help
Entry
HIMB59_00012410   CDS       T02249                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIMB59_00012410
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIMB59_00012410
Enzymes [BR:apc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HIMB59_00012410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1131988..1132758
Genome map
AA seq 256 aa AA seqDB search
MNILDQIVLEKKNIIKYLKQKNLHARKIPKKKSLFKKSIIQEIKKQKNALIVEFKRFSPS
VKNFNKIRSIQNTIEIYDKSKCCCISILTDKNFGGSLNDISIAKKLTNKPIIRKDFIIDK
TQILESKLYGADAILLIAKILTRKQIEDLYQYANELNLDVLIEIESIHEISKIKNIKNSL
IGINNRNLKEQKINIDKSINLSNLIKNKNFIVSESGIDIKNIKKIKEATNIKTFLIGGSI
LNSNKTLNYINKLYNS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcttgatcaaatagtcttagaaaaaaagaatataatcaaatatttgaaacaa
aaaaatttacatgctagaaaaattccaaaaaaaaagagcctattcaaaaaatctattatt
caagaaattaaaaaacaaaaaaatgctttaattgtagaatttaagcgttttagccccagt
gtaaaaaattttaataaaatcagaagcatacaaaataccattgaaatttatgataaatca
aaatgttgttgtatttcaatactcactgataagaattttggtggtagtttaaatgatatc
tctatagctaaaaagttaacaaataaaccaataataagaaaagattttatcatagataaa
actcaaattttggagtctaaactttatggagcagatgccattttattaatagcaaaaatt
ttaacaagaaaacaaattgaagacctttatcaatatgcaaatgaattaaacttagatgtt
ttaattgagatagaaagtattcatgaaatatcaaaaattaagaatattaaaaattcttta
attggaataaataatagaaatttaaaagaacaaaagataaatatagataaatcaattaac
ttaagtaatttaataaaaaataaaaactttattgttagtgaaagtggaattgatatcaaa
aatattaaaaaaattaaagaagcaacaaatattaaaacttttttaattggaggaagtatt
ttaaattctaataagacactcaattatattaataaactttataactcataa

DBGET integrated database retrieval system