KEGG   Alpha proteobacterium HIMB59: HIMB59_00012530Help
Entry
HIMB59_00012530   CDS       T02249                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase family protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00900  Terpenoid backbone biosynthesis
apc01100  Metabolic pathways
apc01110  Biosynthesis of secondary metabolites
apc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HIMB59_00012530
Enzymes [BR:apc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HIMB59_00012530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C Peptidase_S66
Motif
Other DBs
NCBI-ProteinID: AFS49433
UniProt: J9Z0R9
Position
complement(1143739..1144593)
Genome map
AA seq 284 aa AA seqDB search
MDYGCESLKYLNIILRKNSNSIIAVANKELIIAAGPNLIKNFKKNKNQFIPLDSEHFSLK
NNFLSNNNIKKIYITASGGPFYFKKYKDLNNVNFKDVINHPKWTMGISNSIDSSNFINKL
LEIHELTYIYDINIEKINFYISRNAYIHSLVEYIDGTITINCYNNNMLIPLVFPLLSIDP
NIRLKLPKMYFDHKMFALEKYNDKRFKLLKHFSFLKRLSHNNVIKLLLLNNKAHDLYINN
KLKYNDIIPYIIKKLKRDYNNVDLSNFNKTLKFINNFKNNYEIY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttggactatggatgtgagtccttaaaatatctaaatataatattaagaaaaaattcaaat
tcaataattgcagttgcaaacaaggaattaataattgccgctggaccaaatttgataaaa
aattttaagaaaaataaaaatcaattcatccctttagactcagagcacttttctttaaaa
aataactttttatctaataataatataaagaaaatttacataacagcttcaggtggtcct
ttttattttaaaaaatataaagacttaaataatgttaattttaaagatgtaattaatcat
ccaaaatggactatgggaataagcaattctattgattcatctaactttataaataaatta
ttagaaatccatgaattaacatatatctatgatattaatattgaaaaaataaatttttat
atatcaagaaatgcttatattcatagtctcgttgaatacattgatggaaccattactata
aattgttacaataataacatgttaattcctctggttttcccattactaagcatcgaccct
aatataagattaaaactaccaaaaatgtattttgaccacaaaatgtttgcactagaaaaa
tacaatgacaaaagattcaaattgctcaaacatttctcttttttgaaaagattaagtcat
aataatgtcattaaattattattgctaaacaataaagctcacgatttgtatattaataat
aaattaaaatataatgacataataccttatataattaaaaaacttaaaagagattataat
aatgttgatttatcaaactttaataaaacacttaaatttattaataattttaaaaacaat
tatgaaatttattaa

DBGET integrated database retrieval system