KEGG   Alpha proteobacterium HIMB59: HIMB59_00013880Help
Entry
HIMB59_00013880   CDS       T02249                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB59_00013880
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HIMB59_00013880
   00640 Propanoate metabolism
    HIMB59_00013880
   00660 C5-Branched dibasic acid metabolism
    HIMB59_00013880
Enzymes [BR:apc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HIMB59_00013880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1276722..1277909
Genome map
AA seq 395 aa AA seqDB search
MNLHEYQAKILLKNNDVRVLAGNPVLNDNEIDSAVDSIQTPVMVVKSQIHAGGRGAGKFK
DSGDDKGGVRVCFSKEEAKENAKKMLGKTLVTKQTGPDGKVVNRLYIEEGCDIKKEYYLS
MLVDRSTSSISIIASTEGGMEIEEVAEKEPEKIITVNVPGDQTLDQASLDQLVQGLEITS
EQSGDFCDQIQKIYSSFLSADASLVEVNPFVLTGEGNFLALDAKVSIDDNALYKHKDIAE
MRDETEEDPAEIEASKHELNYVKLDGSIGCMVNGAGLAMGTMDIIQLHGGSPANFLDVGG
GATKERVAKAFSIILQDPNVKVILVNIFGGIMKCDIIAEGVVAAAKELSIQVPLVVRLEG
TNVDLGKEILNKSGLAIISADNLEDAAQKAVGALS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtaccaagcaaaaatattgcttaaaaataatgatgtaagagtttta
gctggtaacccagttttaaacgacaacgagatagactctgctgttgactctatccagacg
ccggtaatggttgtgaaatcacaaattcatgctgggggaagaggtgcaggaaaatttaaa
gatagcggcgatgataaaggtggagtgcgagtttgtttttcaaaagaagaagcaaaagaa
aatgcaaagaaaatgcttggtaaaacacttgtaacaaaacagactggaccggatggtaaa
gtcgttaatcgtctttatatcgaagagggctgcgatattaaaaaagaatactatctcagt
atgttagtagatcgttcaacctcctccatctctattatagcttcaactgaaggtggaatg
gaaattgaagaagtagctgaaaaagaacctgaaaaaattatcactgtaaacgttcctggt
gatcaaactttagatcaagctagcttagatcaattagttcaaggtttagaaattacttct
gaacaatctggagatttttgtgatcagattcaaaaaatttattccagctttttatcagca
gatgcttctctagttgaggtaaacccatttgtattaactggtgagggaaacttccttgca
cttgatgcaaaggtatcgatcgatgacaatgctttatacaaacacaaagatattgccgag
atgcgagatgagacagaagaagatccagctgagatagaagcatctaaacatgagttaaat
tatgtaaaactagatgggagtatcggatgtatggttaatggcgcaggtcttgctatgggt
accatggatattatccaacttcatggtggaagcccagcaaacttcttagatgttggtggt
ggagctacaaaagaaagagttgctaaagccttttcaatcattcttcaagatccaaatgtt
aaagtcattctggtaaacatttttggtggcattatgaaatgcgatatcatagctgaaggt
gttgttgctgccgctaaagaactatccattcaggttcctttagttgttagacttgaggga
acaaacgtagatcttggaaaagaaattcttaataaatcaggtctagctattatttcagca
gataatttagaagacgcggctcaaaaggctgtcggtgctttgagttaa

DBGET integrated database retrieval system