KEGG   Alpha proteobacterium HIMB59: HIMB59_00014810Help
Entry
HIMB59_00014810   CDS       T02249                                 

Definition
Asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:apc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1359937..1361601
Genome map
AA seq 554 aa AA seqDB search
MCGFLITCDNNIQIDKFNKSFEQIRSRGPDESRITQHKNILKMGFHRLSIIDDHERSMQP
FFYKNKILLYNGEFYNYVHIKKKIQNNHKIEFHTNSDTEVFLQNILINGIEGYEDIIGMF
AFAIFDKEKNEIKFGRDNFGIKPLYYYFDHKSLIISSSIKSVNIIAQQKINNFNLINFNK
YGFTYGDETIYQNINECKPGIEYTIDLNMKTLRSKSFFNLKNIISNQKNNFINNKVDYFK
ENIKLHLVSDVKSCVLKSNGIDSNLIAYYKNEIQKKNEYIYFDKNNINFKIQHSQQNFNS
ISLSEDEYQNYFHEYLDSLEYPTIDGFNTYLITKISNQNKYKVCLSGLGLDEIFDGYGIS
KKIRLAKILNSLKFFKKFTYKPNNIKIDKLISCANCSDILDYYLEIRKISTQKNLFKKFE
TKEIENHRLKLKTLMLESLSITNISTYKKNDLIKLFEFEFYLKNQLLKDSDFFSMLNSVE
LRVPFVEKMFIENISVDNPNNINKRKYLFLNYKSILNNLNIEKQKEGFIAHNFYKLKGIK
NYENIINIVNKKFI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttttaataacttgtgacaataatattcaaatagataaattcaataaatct
tttgaacaaattcggtctcgcggtccagatgaaagtaggataacacagcacaaaaatata
cttaagatgggtttccatcgattatcaataattgatgatcatgaaagaagcatgcagcct
tttttttataaaaataaaattcttttatataacggtgaattttataattatgttcatata
aaaaaaaaaattcaaaacaatcataagatagaattccataccaactcagatacagaagtg
tttctacaaaatattttaataaatggcattgaaggttatgaagatattattggtatgttt
gcctttgcaatttttgataaagaaaaaaatgaaattaagtttgggagagataactttggc
attaaaccactatactattattttgatcataaatctcttatcatttcatctagtatcaaa
tcagtaaatataatagctcaacaaaaaatcaataattttaatttaataaattttaataaa
tatggttttacatatggtgatgaaactatttatcaaaatataaatgaatgtaagcctggt
attgaatatacaatagatttaaatatgaaaactttacgttcaaaaagtttttttaattta
aaaaatataatttcaaatcaaaaaaataatttcataaataataaagtagattattttaaa
gaaaatatcaaacttcacttagtttctgatgtaaaaagctgtgttttaaaatctaatggg
atagattcaaacttaattgcatactataaaaatgaaattcaaaaaaagaatgaatatatt
tattttgataaaaataatattaattttaaaatccaacattctcaacaaaactttaattcg
attagtttaagtgaagatgaatatcaaaattattttcatgagtatttagactcacttgag
taccctactattgatggtttcaatacttacttaattactaaaatttcaaatcaaaataaa
tacaaagtctgtctttctggattaggattggatgaaatatttgatggatatggcataagt
aaaaagattagactagcaaaaattcttaattcattaaaattttttaaaaaatttacatac
aagccaaataacatcaaaattgataagttaattagttgtgcaaactgtagtgacatacta
gattattatttagagataaggaagatttcgacccaaaaaaatttgtttaagaaatttgaa
acaaaggaaattgaaaatcacagattaaaattaaaaacattaatgcttgagagtttatct
ataacaaatatctccacttataaaaaaaatgatttgattaaattatttgaattcgaattt
tacctaaagaatcaacttttaaaagatagtgattttttttctatgcttaattctgttgaa
ttaagagtgccatttgttgagaaaatgttcatcgaaaacatatcagttgacaaccccaat
aatataaacaaaagaaaatatctatttctgaattacaaatccatacttaataatttaaat
attgaaaaacaaaaagaaggttttattgctcataatttttataaattaaaaggaataaaa
aattatgaaaatataatcaacattgtaaataaaaaatttatttga

DBGET integrated database retrieval system