KEGG   Anaplasma phagocytophilum Dog2: YYY_01985Help
Entry
YYY_01985         CDS       T02752                                 

Definition
ubiquinol-cytochrome C reductase
Orthology
K00411  
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
apd  Anaplasma phagocytophilum Dog2
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:apd00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    YYY_01985
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YYY_01985
Enzymes [BR:apd01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.2  quinol---cytochrome-c reductase
     YYY_01985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
412937..413521
Genome map
AA seq 194 aa AA seqDB search
MKGNDMADDDIASGKSEGFAGEVQRRDFLGLTTLFMSFIGIFSFLYPLFRSLSPSAEVMA
QSTVEVDLTSIKEGSTKVVKWQGKPVFVRRRTKEEIEKARAVDISGLRDPQTDQQRTFVG
KEEWLVMVGICTHLGCVPTEVKSGDKGWYCPCHGSKYDTSGRILAGPAPLNLPIPDYHFV
DDSTMVIGKKGTAV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggggaatgatatggctgatgatgatattgcttctggtaagagtgaaggttttgct
ggagaagtacaaaggagagattttttggggctcaccactctttttatgtcatttataggt
attttttcttttttatatcctttattcagatcgttgagtccttcggccgaggttatggcc
caatcaacagttgaggtagatttaaccagtataaaagaaggtagcaccaaggttgttaag
tggcagggcaagcctgtgtttgttcgaagacgtacgaaggaagagatagaaaaggctaga
gctgtagatatatctggattgcgtgatcctcagactgatcagcagcgcactttcgttggg
aaagaagagtggttagtcatggtaggtatatgcactcatctagggtgtgttcctacggag
gttaaaagtggtgataaggggtggtattgcccgtgtcatggttcgaaatatgacacttct
gggaggattttggctgggcctgcgcctttaaatttgccaatacctgattatcattttgta
gatgatagtactatggtaattggcaagaagggtactgctgtgtag

DBGET integrated database retrieval system