KEGG   Aeropyrum pernix: APE_0012Help
Entry
APE_0012          CDS       T00023                                 

Definition
ATP-dependent 6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ape  Aeropyrum pernix
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    APE_0012
Enzymes [BR:ape01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     APE_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8908..9840
Genome map
AA seq 310 aa AA seqDB search
MLEHLVQAVAVGHALVDLRLYVERIPGVDEEAVIKDETRSVGGSAANVAVVLRRLGVQSG
IIGKIGLDDFGRIAVDNLMREGVDISGLRVSLRDRTGFSVVVRDKEGSITIYSFKGAAEK
LEPGEIDADAIGRSKHVHVASLRPDTTLKTVEIAKKRSITVSWDPGRVLSKMGAERLANI
ISKVDIIFVNRNEAKNLTGYHDYRQAARHLKKLGPKIVVIKLGASGSYILYSDGEVFVPA
IKPERVVDTTGAGDSYAAGFIAGLLRGYTIEKASLYATIVASIKVSRLGSNAAPSHEEVV
EKARELGVEI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgctagagcatctggtgcaggctgttgctgtaggtcacgctcttgtcgatctcaggctg
tacgttgagagaataccgggtgtagacgaagaggcggtgattaaggatgagacgagaagt
gtgggaggttctgcggcgaacgtggctgtagtgttgagaaggttaggggttcagtcaggc
attattggaaagatagggctggacgacttcgggaggatagccgtggacaatcttatgaga
gaaggagtggacatctctggcctccgagtatctctgcgggataggactgggttctccgtg
gttgtgcgtgacaaggaagggtcgataactatttacagttttaaaggcgctgctgaaaag
ctcgagccaggggagattgacgcggacgctataggtagatcaaaacacgtacacgttgcc
agtctaaggcccgatactactcttaaaaccgtagagatcgctaagaaacgttccataact
gtttcatgggatccgggcagggttttatcgaagatgggagccgagaggcttgccaatata
atttctaaagtggacatcatctttgttaataggaatgaggcgaagaatcttacagggtat
catgattataggcaagctgcaaggcaccttaaaaaacttggtccaaaaattgttgtgata
aagctgggagccagcggatcatacatcctttatagtgatggtgaggtattcgttccagcc
ataaagccggagagagttgtggatacaactggtgctggcgattcttatgcggcaggcttt
atagcgggtcttctcaggggctacactatagaaaaagcctctttgtatgctactatcgtc
gcctcaataaaagtatctaggcttggatctaacgcagctccctctcatgaggaagtggtt
gaaaaagccagagagctcggggtggagatttag

DBGET integrated database retrieval system