KEGG   Aeropyrum pernix: APE_0306.1Help
Entry
APE_0306.1        CDS       T00023                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ape  Aeropyrum pernix
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    APE_0306.1
Enzymes [BR:ape01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     APE_0306.1
Exosome [BR:ape04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APE_0306.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223391..224818
Genome map
AA seq 475 aa AA seqDB search
MGDSLLCSVDVGTSGIRLSLYGEDLGLVARYTEELTLYYSGNRVEQDALILAANVRDMLG
KAARSGCNVVGLSIYRGSVVAWRNGKPLSDVITWMDSRGLEEYSKLPLGARLVSKSPVLG
KALKPGSPALVMRRLWLNHPGARIWSIDGFLSDMLTGEFTSDPGQAALTGLVSPYSLKPL
SLVIRLLGLRGLELPRLRLHNEPLTRVGGVLVGPMVADQQAASIGLGCLRPGCVKATLGT
GLFLDAPVEGKPPLFTGDLIPVVNLALPGRVYYGLEGFAAGVGMVFDAFARVLGGFSVLE
EKALEPADPAPVVPVLAGLRTPYRPLLRGAVLGVSPGFTAASLAKGLIIGTLLTVLSIYR
ELARRMGGFGELRIGGGLSRLGLLASSIASAVGVKVYRSVDYNDSARGAALVAGYASDLI
SREELLNPPVSLVEVEPLEELSLSGVDAWLGLVDALASEDFSRRLEEIRRSSFRR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgatagcttactctgtagcgttgacgttggaacctctgggattaggctaagttta
tacggtgaggacctagggctagtggccagatataccgaagagctcactctctactatagt
gggaatagggttgagcaggacgccttgattcttgcggctaatgttagggatatgctgggg
aaggcggcgaggtcagggtgtaatgtagtaggcctgtccatctataggggttctgtggtt
gcttggagaaatggtaaaccactaagtgatgtgattacgtggatggattcaaggggtttg
gaggaatattcgaaactccctctcggtgccaggcttgtttcgaaatcgcctgtgttgggg
aaggctctaaagcctgggtctccagcgcttgtgatgaggcggctatggctcaaccacccg
ggagccaggatttggagcattgacgggttcctttctgacatgttaaccggagagtttaca
agtgatcctggtcaggccgccctaacaggccttgtgagcccctacagcttgaaaccactc
agcctcgttatcagacttctaggtctaagggggcttgagctaccaaggcttaggcttcac
aacgagcccttaacacgggttggaggggttcttgtggggcctatggttgcggaccagcag
gctgcatcaataggcctgggctgcttaaggccggggtgtgttaaggccacccttgggaca
ggccttttcctggacgcgccagttgagggcaagcctcccctcttcaccggggatctcata
cccgttgttaacctcgccctgcccgggcgggtctactatggtcttgagggcttcgctgct
ggtgtgggtatggttttcgacgctttcgcgagggttctaggcgggtttagcgtgttggag
gagaaggcgttggagcctgctgatccggctcccgtggttccggtgctcgcaggcctcaga
acgccgtataggccgctcctgcggggtgcggtgctcggcgtatctccgggtttcactgca
gcttctctcgccaagggtctcataataggcaccctactgacagtgctctccatctatagg
gagctcgcccgtaggatggggggtttcggggagctcagaataggaggagggctctccagg
ctaggccttctagcctcctctatagcttccgccgtgggagttaaggtgtataggagcgtg
gactataacgattctgcacggggcgccgctctagtggctggatatgcgtctgacctcata
tctagggaagagcttctaaaccctcctgtcagcctagttgaggtggagcccttggaggag
cttagcctcagtggtgttgatgcttggctcggcttggtggatgccctggcctcggaagac
ttctcgagaaggttagaggagatccggaggtcgagctttcggaggtag

DBGET integrated database retrieval system