KEGG   Aeropyrum pernix: APE_0316.1Help
Entry
APE_0316.1        CDS       T00023                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ape  Aeropyrum pernix
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ape00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(229719..230375)
Genome map
AA seq 218 aa AA seqDB search
MGDVTARSYREVVSAVEEKVASLRGGRLFIFLGGDHSITYATLRALRSFYRGRLGLVYLD
AHPDLYDEYEGDRYSHACTLRRIVEEGFVDPRDVILAGVRAATPSQLDFAEKAGITVLGV
EEAEDLAAYLKEGMPYYISYDLDVLDPAYAPGVGNPEPGGLSTREMVRIIKSLPEDVLAF
DVVEASPPHDPSGLTLFTAAKIIRETLARARPPGWGEV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgacgtgacggcaaggagctatagggaggtggtgagtgctgttgaggagaaggtc
gcctctctccggggaggcaggctcttcatattcctgggtggagaccactccataacatat
gccactctcagggccctaaggtctttttataggggtaggctgggcctggtatatctcgac
gcccatcctgacctttacgacgagtacgagggcgacaggtatagccatgcctgcacgctg
aggaggatagtggaggaggggttcgtcgatccgcgagacgttattctcgcaggcgtgagg
gcggcaacccccagccagctggacttcgccgaaaaggcaggtataaccgtcctaggcgtt
gaggaggctgaggacctggcggcttatttgaaagagggcatgccgtactacatctcctac
gatcttgacgtgctcgatcctgcctacgcgccaggtgtgggcaaccccgagcccggcggt
ctatctaccagggagatggtgaggattattaaaagccttccagaggatgtgctggcgttc
gacgttgtcgaagcatcaccgccccacgacccctcggggctgactctcttcaccgcggcg
aaaataataagggagactctggcgagagcccgccctcccggctggggagaggtgtga

DBGET integrated database retrieval system