KEGG   Aeropyrum pernix: APE_0316.1Help
Entry
APE_0316.1        CDS       T00023                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ape  Aeropyrum pernix
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    APE_0316.1
Enzymes [BR:ape01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     APE_0316.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(229719..230375)
Genome map
AA seq 218 aa AA seqDB search
MGDVTARSYREVVSAVEEKVASLRGGRLFIFLGGDHSITYATLRALRSFYRGRLGLVYLD
AHPDLYDEYEGDRYSHACTLRRIVEEGFVDPRDVILAGVRAATPSQLDFAEKAGITVLGV
EEAEDLAAYLKEGMPYYISYDLDVLDPAYAPGVGNPEPGGLSTREMVRIIKSLPEDVLAF
DVVEASPPHDPSGLTLFTAAKIIRETLARARPPGWGEV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgacgtgacggcaaggagctatagggaggtggtgagtgctgttgaggagaaggtc
gcctctctccggggaggcaggctcttcatattcctgggtggagaccactccataacatat
gccactctcagggccctaaggtctttttataggggtaggctgggcctggtatatctcgac
gcccatcctgacctttacgacgagtacgagggcgacaggtatagccatgcctgcacgctg
aggaggatagtggaggaggggttcgtcgatccgcgagacgttattctcgcaggcgtgagg
gcggcaacccccagccagctggacttcgccgaaaaggcaggtataaccgtcctaggcgtt
gaggaggctgaggacctggcggcttatttgaaagagggcatgccgtactacatctcctac
gatcttgacgtgctcgatcctgcctacgcgccaggtgtgggcaaccccgagcccggcggt
ctatctaccagggagatggtgaggattattaaaagccttccagaggatgtgctggcgttc
gacgttgtcgaagcatcaccgccccacgacccctcggggctgactctcttcaccgcggcg
aaaataataagggagactctggcgagagcccgccctcccggctggggagaggtgtga

DBGET integrated database retrieval system