KEGG   Aeropyrum pernix: APE_0317.1Help
Entry
APE_0317.1        CDS       T00023                                 

Definition
phospho-sugar mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ape  Aeropyrum pernix
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APE_0317.1
   00030 Pentose phosphate pathway
    APE_0317.1
   00051 Fructose and mannose metabolism
    APE_0317.1
   00052 Galactose metabolism
    APE_0317.1
   00500 Starch and sucrose metabolism
    APE_0317.1
   00520 Amino sugar and nucleotide sugar metabolism
    APE_0317.1
  Nucleotide metabolism
   00230 Purine metabolism
    APE_0317.1
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    APE_0317.1
Enzymes [BR:ape01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     APE_0317.1
    5.4.2.8  phosphomannomutase
     APE_0317.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(230611..232005)
Genome map
AA seq 464 aa AA seqDB search
MSRRRLFGTDGVRGVIGSELTPEFVLRLARAIGAYFGRGSRILVGRDTRSGGELFEGLVA
AGLAFEGVEVHLAGTLPTPALQLYVRDHGYDAGVMVTASHNPPEYNGIKVVGGDGVEVPR
DVEEGIEALFWEGKFSTVEWRSVAGQPKRVHDAVDYYVNRVVENVSAFTQRGGGERVVVD
CGGGATSFTTVEILKRLGARPIPLSCKPDPLFSSRDPEPTPDTLGPAASLVRSSGAVFGV
GHDADGDRAIVIDDRGRVVWGDRSGALLAGFVAEVGLAKGPLKVYTGVSSSIVVEDYLRP
RGIEVVWTPVGAPIIARAILTQGGIAAFEENGGYMHPPHQYVRDGGMKAALLLAMLRATG
ESLSSLLDRLPSYHPIKTKIPASREEALCAVEAVKQEFQGERMVTIDGVKVIGEGYWVLV
RPSGTEPVVRIMLEARSEEEARALFERVLRAVKEKCGIPSGGRT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgaggaggaggcttttcgggactgatggcgtgaggggcgttatagggtcggagctg
actcccgagttcgtcctcaggcttgccagggccattggggcttactttggcaggggtagt
aggattctcgttggcagggataccaggtctggaggggagcttttcgagggtcttgtggct
gctggccttgctttcgagggcgtggaggtccacctcgccggcaccctgcctaccccagct
ctgcagctttatgttagggatcacggctacgatgccggtgttatggtgactgcaagccac
aaccctccggagtataatgggataaaggttgtgggtggtgatggtgttgaggttcctagg
gatgtagaggagggcattgaggctctattctgggagggcaagttttcgactgtcgagtgg
aggagcgtcgctggccagcccaaacgcgtccacgacgccgtcgactattatgttaacagg
gtggttgaaaacgtttcagccttcacccagcgcggcggcggggagagggttgtcgtggac
tgcggcggcggggcaactagcttcacaacagtcgagatactaaagaggctgggggccagg
cctatacccctcagctgcaagcccgaccccctgttctcctccagggatccggagccgact
cccgatactctggggccagcggctagtctggtgaggtcctcgggtgcagtatttggcgtg
ggccatgatgctgatggggatagggctattgtaatcgatgatagaggccgggtcgtgtgg
ggcgataggagcggcgccctcctggcagggtttgtcgccgaggtggggctggcgaagggc
ccgctcaaggtctacacaggcgtgtctagcagcatagttgtggaagactatctacgcccc
cgcggcatagaggttgtttggacacccgttggagcccccataatagccagggctatactg
acccaggggggtatagcagcctttgaggagaacggcggctacatgcacccaccgcaccag
tatgttagggacggggggatgaaggcggccctcctattggctatgctgagggcgacgggg
gagagcttgtcctcactcctggatagactccccagctaccacccgataaaaacaaagata
ccggcgtctagggaggaggcgctatgtgccgtggaggctgtcaagcaggagttccagggc
gagaggatggtcaccatcgacggtgtgaaagtcataggcgaggggtactgggttctcgta
aggcccagcggcacggagcccgttgtaaggataatgttggaggccaggagcgaggaggag
gctagggcgttgttcgagagggtgcttagggctgtcaaggaaaagtgcggcataccctcc
ggcggcaggacctag

DBGET integrated database retrieval system