KEGG   Aeropyrum pernix: APE_0632.1Help
Entry
APE_0632.1        CDS       T00023                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ape  Aeropyrum pernix
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APE_0632.1
  Amino acid metabolism
   00300 Lysine biosynthesis
    APE_0632.1
Enzymes [BR:ape01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     APE_0632.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(429927..431186)
Genome map
AA seq 419 aa AA seqDB search
MTASLNPGALEEAFGYSVDVLKRLISIPTVAPQGDHYGEAAELLARELESLGFETVVERV
PSEYQREKCRHASDNPRFIVYGRRGEGPALHFNGHYDVVPGGPGWSVTEPFKPVVKDGKL
YGRGAIDMKGGIAAALGAFKALHLSGAWPQGLRVEAAFVPDEEIGGECGTGYLVNGMGVT
PEYVVLPEPSGLEKPWHGHRGILWMKVRVKGRTAHASTPWHGRNAFLLASAIALDLQQAL
ASMYAGRRSRHRIEPEESAKPTVSLGGEAGVTGGGKTNQVPGEFYFTVDRRLIPEETVSQ
ARDELLGVLTWLSVKHGAEVEAEEVISAEPAINEPGELYEALREAASQSGRSIGEPVVCP
GGLDMWYYTVKGSKALAYGPRGELAHAPDEHIDLGELRFLVETFARLPITLAVALQRRT
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcctctctaaaccctggtgctctagaggaggctttcggctattctgttgacgtg
ttgaagaggctcatatcaataccgaccgtcgcgccgcagggcgaccactatggggaggcc
gccgagcttctggccagggagctggagtccctgggcttcgagacggttgtggagagggtc
ccctccgagtatcagagggagaagtgtaggcacgcctccgacaatccaaggtttatagta
tatgggcggaggggcgagggcccggccctccacttcaacggccactacgacgtggtccct
gggggtccggggtggagtgtaaccgagcctttcaagcccgtggtcaaggatgggaagctc
tacggccgcggcgctatagacatgaaggggggtatagcggcggccctcggcgccttcaag
gccctccacctctccggggcctggccccaggggctaagggttgaggcggccttcgtgccc
gacgaggagatcgggggagagtgtggcacaggctatctagtcaacggcatgggggtgacc
cccgagtacgtcgtgctgcccgagcccagcggccttgagaagccgtggcacggccacagg
ggtatactgtggatgaaggttagggtgaaggggaggaccgcccacgccagcacgccgtgg
cacgggaggaacgcgttcctcctggcgtcggccatagccctcgacctccagcaggcgctg
gcctctatgtacgctggcaggaggagcaggcacaggatagagcctgaggagtcggccaag
cccactgtatcgctaggtggcgaggcgggggtgacggggggaggtaagacgaaccaggtg
ccgggcgagttctacttcaccgtggacaggcggctcatacccgaggagactgtatcgcag
gctagggacgagctgttgggggtgttgacctggctctcggtgaagcatggggcggaggtt
gaggcggaggaggttatctcggccgagcccgctataaacgagccgggtgagctgtacgag
gccctgagggaggcggccagccagtccggcaggagcatcggcgagcccgtcgtctgcccc
ggaggcctcgacatgtggtactacacggtcaaaggctctaaggccctggcatacggcccc
cgcggcgagctggcccacgctcccgacgagcacatcgacctgggcgagctgaggttcctc
gttgagacgttcgccaggctgcccatcaccctggcagtggccctgcaacggcgaacttga

DBGET integrated database retrieval system