KEGG   Aeropyrum pernix: APE_0947Help
Entry
APE_0947          CDS       T00023                                 

Gene name
sdhD
Definition
succinate dehydrogenase subunit D (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ape  Aeropyrum pernix
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APE_0947 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APE_0947 (sdhD)
   00650 Butanoate metabolism
    APE_0947 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    APE_0947 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(620226..620579)
Genome map
AA seq 117 aa AA seqDB search
MAVKSSYMQLLQYVTAALLVVLVSWHLALRLPWLHGVESFVHTLMPEVVYREITSFSLLL
LLAYTALIHGVNGLRIILLEVHHGELWDKAVNAAAVLALLVFGALATYTVVGVEPPA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtggctgtgaagtctagctacatgcagcttctccagtatgtcacggctgctctcctagtt
gtactcgtctcatggcacctggccctcaggctgccctggctccacggagtcgagagcttt
gtgcacacgctaatgccggaggtagtctacagggagataaccagcttcagcctcctcctg
ctcctcgcctacacagccctcatccacggcgtcaacggcctgaggataatactcctggag
gtgcaccacggggagttgtgggataaggccgtgaacgccgccgctgttctagccctactg
gtcttcggcgccctggcaacctataccgtggtgggggttgagccgcccgcatag

DBGET integrated database retrieval system