KEGG   Aeropyrum pernix: APE_0947Help
Entry
APE_0947          CDS       T00023                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ape  Aeropyrum pernix
Pathway
ape00020  Citrate cycle (TCA cycle)
ape00190  Oxidative phosphorylation
ape00650  Butanoate metabolism
ape00720  Carbon fixation pathways in prokaryotes
ape01100  Metabolic pathways
ape01110  Biosynthesis of secondary metabolites
ape01120  Microbial metabolism in diverse environments
ape01130  Biosynthesis of antibiotics
ape01200  Carbon metabolism
Module
ape_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ape_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ape_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APE_0947 (sdhD)
   00650 Butanoate metabolism
    APE_0947 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    APE_0947 (sdhD)
   00720 Carbon fixation pathways in prokaryotes
    APE_0947 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: BAA79931
UniProt: Q9YDG6
Position
complement(620226..620579)
Genome map
AA seq 117 aa AA seqDB search
MAVKSSYMQLLQYVTAALLVVLVSWHLALRLPWLHGVESFVHTLMPEVVYREITSFSLLL
LLAYTALIHGVNGLRIILLEVHHGELWDKAVNAAAVLALLVFGALATYTVVGVEPPA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtggctgtgaagtctagctacatgcagcttctccagtatgtcacggctgctctcctagtt
gtactcgtctcatggcacctggccctcaggctgccctggctccacggagtcgagagcttt
gtgcacacgctaatgccggaggtagtctacagggagataaccagcttcagcctcctcctg
ctcctcgcctacacagccctcatccacggcgtcaacggcctgaggataatactcctggag
gtgcaccacggggagttgtgggataaggccgtgaacgccgccgctgttctagccctactg
gtcttcggcgccctggcaacctataccgtggtgggggttgagccgcccgcatag

DBGET integrated database retrieval system