KEGG   Aeropyrum pernix: APE_1011.1Help
Entry
APE_1011.1        CDS       T00023                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ape  Aeropyrum pernix
Brite
Enzymes [BR:ape01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     APE_1011.1 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltr_RsmB-F Methyltransf_11 GCD14 Met_10 MTS RrnaAD Methyltransf_3 Fibrillarin Methyltransf_24 Methyltransf_18 Methyltransf_32 Ubie_methyltran Methyltransf_23 Cons_hypoth95 DREV CMAS PrmA
Motif
Other DBs
NCBI-ProteinID: BAA79996
UniProt: Q9YDA1
Position
659066..659848
Genome map
AA seq 260 aa AA seqDB search
MKSPVAGAVLDPSTPPPTTGTSWRWPGLRDADPYREARLRMVEQLRRSGLVTSRRVLEAM
ARVPRHLFVPPEYRGMAYEDRPLPIGHGQTISAPGVVGRMLQLLDPQPGEKVLDVGAGSG
YQSALLAELVTPGGRVYAVERIPELAEYARENLEKTGYRGVVEVVVGDGSKGLPQHAPYH
RIKVAAAAPKPPKPLVEQLAPGGRMVIPIGTPDLQILTIIEKTPDGRVRERRDIEVLFVP
LIGEHGYREDWRKQYWQWWR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagcccggtggcaggggctgttttagacccctccacaccccctcctacaaccggg
acgtcttggaggtggcctgggttaagggatgccgatccctacagggaggctaggctcagg
atggtggagcagcttaggaggagcgggctggtgaccagcaggagggtgctcgaggccatg
gccagggttccccgccacctcttcgtgcccccggagtacagggggatggcgtatgaggac
aggcccctccccataggccacggccagacgataagcgcccccggggtggtggggaggatg
ctccagctcctcgacccccagcccggggagaaggtcctagacgtgggggcgggcagcggc
taccagtccgccctcctcgcagagctcgtaacccccgggggcagggtctacgcggtggag
aggatacccgagctggccgagtacgccagggagaacctggagaagacgggctaccggggg
gtggtggaggttgtcgtgggggacgggagcaaaggcctcccacaacacgccccataccac
aggataaaagtggccgccgcagcacccaaaccccccaaacccctggtggaacagctagcc
cccggcgggagaatggtcatacccataggaacaccagatctccaaatcctaacaatcata
gagaaaacccccgacggcagagtgagggagaggagggacatagaggtcctcttcgtaccc
ctaataggggaacacggatacagagaagactggcggaaacaatactggcaatggtggcga
tga

DBGET integrated database retrieval system