KEGG   Aeropyrum pernix: APE_1065.1Help
Entry
APE_1065.1        CDS       T00023                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ape  Aeropyrum pernix
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APE_1065.1 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APE_1065.1 (sucC)
   00640 Propanoate metabolism
    APE_1065.1 (sucC)
   00660 C5-Branched dibasic acid metabolism
    APE_1065.1 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    APE_1065.1 (sucC)
Enzymes [BR:ape01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     APE_1065.1 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
683610..684746
Genome map
AA seq 378 aa AA seqDB search
MKLYEFEAKEILRMYGVETPPSVLVMPGDDVAAKIREAGLEPPLVVKSQVLVAGRGKAGG
IKLVESVEDAVRVAGELWRKPIKGILPGALLVEKAVPHDAELYTSIIIDRSERRPVILAS
RFGGMDIEEIAREKPESIVRHYVDPFLGLRGYEARMVGKAIGLSGRLLNSYASFLQVLYR
VFTALEAELVESNPLAIVGDKVVPLDARIIVDDNSLFRHRELVERRRVEQRGEYTEWEVK
ARQQGLPFVELEGDIGIIGNGAGLTMATMDLVYHFGGRPANFLDIGGGARAELVKKAVSF
LLEFPKAEKIFINVFGGITRGDEVARGIVAAVRESGSSKPLVVRLSGTREEEGRRILEEA
GIYAYTDPVEAVKKVVSL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctgtacgagtttgaggctaaggagattctgcggatgtacggtgtcgagactccc
ccctctgttctggtgatgccgggcgacgatgtggcggccaagattagggaggcgggtttg
gagccgccgcttgttgtgaagagccaggtactcgtcgccggcagggggaaggccgggggt
attaagctggttgagagtgttgaagacgctgtcagggttgcaggggagctttggcgtaag
cctataaaggggatactcccgggggccctgcttgtggagaaggctgtcccccacgatgcc
gagctgtacacctcgataattatagacaggagtgagaggaggcccgtcatcctggccagc
aggttcggggggatggatatagaggagattgccagggagaagcccgagagcattgtgagg
cactatgtagaccccttcctggggctgaggggctatgaggccaggatggtggggaaggcc
ataggcctctcgggcaggctgctaaacagctacgcatccttcctccaggtcttgtacagg
gtgttcacagccctggaggcggagctcgtcgagagcaacccactggccatcgtcggcgac
aaggtggtccccctcgacgccaggataatcgtggacgacaacagcctgttcaggcacaga
gagctcgtggagaggaggagggttgagcagaggggcgagtacaccgagtgggaggtcaag
gctaggcagcagggactcccattcgtcgagctggagggcgacataggcatcataggcaac
ggagccggactcacaatggccaccatggaccttgtataccacttcggcgggaggcccgcg
aacttcctcgacatagggggcggcgccagggcggagctggttaagaaggccgtctccttc
ctcctagagttccccaaggcggagaagatcttcataaacgtgttcggcggcataacaagg
ggcgacgaggtcgcccgcgggatagtggcggcggtcagggagtccggctccagcaagccc
ctagtggtgaggctcagcggcaccagggaggaggagggtaggaggatactcgaggaggct
gggatctacgcctataccgacccggtggaggctgtaaagaaggttgtatccctctag

DBGET integrated database retrieval system