KEGG   Aeropyrum pernix: APE_1109.1Help
Entry
APE_1109.1        CDS       T00023                                 

Gene name
fbpA
Definition
fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ape  Aeropyrum pernix
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APE_1109.1 (fbpA)
   01230 Biosynthesis of amino acids
    APE_1109.1 (fbpA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APE_1109.1 (fbpA)
   00030 Pentose phosphate pathway
    APE_1109.1 (fbpA)
   00051 Fructose and mannose metabolism
    APE_1109.1 (fbpA)
  Energy metabolism
   00680 Methane metabolism
    APE_1109.1 (fbpA)
Enzymes [BR:ape01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     APE_1109.1 (fbpA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     APE_1109.1 (fbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(699271..700434)
Genome map
AA seq 387 aa AA seqDB search
MSEGRTTTVSVIKADIGSLAGHHRVHPDTILAASRVLAEAKRKGVIKSFYVTNAGDDLQL
IMTHFKGVDNPEIHELAWTAFREATKVAKDLGLYAAGQDLLSDAFSGNIRGLGPGVAEME
FVERPSEPIVVFMADKTEPGAFNLPLYKIFADPFNTAGLVIDPRLHDGFIFEVLDVFEGK
AVELRAPEEIYDLLALIGTPSRYVVKRVYRKSDREIAAVVSSERLSLIAGRYVGKDDPVM
IVRAQSGFPAVGEVLEPFAFPHLVAGWMRGSHHGPLMPVGLKDSKVSRFDGPPRVIALGF
QVKNGELIGPADLFDDPAFDEARRQAQMIADYIRRHGPFMPHRLGPEEMEYTTLPEVLKR
LKDRFKPVEMGYKPKVKHESGEAADVD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgagggcaggactacgactgtgagcgttataaaggcggatataggcagcctcgcg
ggccaccacagggtccaccccgacacaatcctcgccgccagcagggtgctggcggaggct
aagaggaaaggggttatcaagagcttctacgtcaccaacgccggggacgatctgcagctc
atcatgacccacttcaagggcgtcgacaaccccgagatacacgagctggcgtggactgcc
ttcagggaggcgacgaaggtggccaaggatctgggtctctacgccgccggccaggacctg
ctgagcgacgctttcagcggcaacatacgcggcctaggcccgggcgtcgctgagatggag
ttcgtcgagaggccgagcgagcccatcgtggtgttcatggccgacaagaccgagcccggc
gccttcaacctacccctctacaagatattcgccgaccccttcaacaccgccgggctggtg
atagacccgaggctgcacgacggcttcatattcgaggtcctcgacgtgttcgagggcaag
gcggtcgagctgagggcgccggaggagatatacgacctcctcgccctcataggcacgcca
agcaggtacgttgtcaagagggtgtacaggaagagcgacagggagatagcggcggtggtg
agcagcgagaggctcagcctgatagccgggaggtacgtcggcaaggacgacccggtgatg
atagtcagggcgcagagcgggttccccgccgtcggcgaggtgctggagcccttcgccttc
ccacacctcgtcgccggctggatgaggggcagccaccacggccccctaatgccagtgggc
ctgaaggactcgaaggtctcgaggttcgacgggccgccgagggtcatagccctcggcttc
caggtgaagaacggcgagctcataggcccagcagacctcttcgacgacccggccttcgac
gaggcgaggaggcaggcgcagatgatagccgactacataaggaggcacggccccttcatg
ccccacaggctagggccggaggagatggagtacacaacactacccgaggtcctcaagagg
ctgaaggacaggttcaagccggtggagatggggtacaagccgaaggtcaagcacgagtcg
ggagaggcggcggacgtagactag

DBGET integrated database retrieval system