KEGG   Aeropyrum pernix: APE_1245.1Help
Entry
APE_1245.1        CDS       T00023                                 

Definition
zinc-binding dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ape  Aeropyrum pernix
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    APE_1245.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APE_1245.1
  Lipid metabolism
   00071 Fatty acid degradation
    APE_1245.1
  Amino acid metabolism
   00350 Tyrosine metabolism
    APE_1245.1
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APE_1245.1
   00626 Naphthalene degradation
    APE_1245.1
Enzymes [BR:ape01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APE_1245.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(791720..792700)
Genome map
AA seq 326 aa AA seqDB search
MRAAVLYGPGDVRVEDLPPPEQPEGWALVRSRAVGICGTDKAFYRGTYPLFKKPLVPGHE
VSGEVVEGPEDLVGSRVVSEINFACLRCEVCREGLYTHCPRKKTLGIDFDGGMAEYFTAP
PWALHPHNMPHEKAFAAEPLAAVLNALQQAPPRPGWAVAVLGTGFMAHLTAQTLTAYGFK
PAIVARPDSPKAVFFRRLGLEVLTPEEAVKAASETPGGLGFHMVFETTGSNQGLSIATAL
ARPRGVVHVKSTPGGEAVFSQTLAVVKEIRLIGTRCGSHREFKEALRLLESGEVEPQVTK
FRSLEEAPEAFEASLDRESMKIVVTI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ttgagggctgccgtcctatatgggccgggtgatgtaagggttgaggacctcccgcccccc
gagcagcctgagggctgggcgctggttaggagcagggccgtggggatatgcggtacggat
aaggccttctacaggggcacctacccgctgttcaagaagcccctggtgcccgggcatgag
gtttcgggtgaggttgtggaggggcctgaggacctcgttggctctagggtcgtgagcgag
attaacttcgcctgcctccgctgcgaggtatgcagggaggggctctacacccactgcccc
cgcaagaagaccctaggaatagacttcgacgggggcatggcggagtacttcaccgcaccc
ccatgggccctccacccccacaacatgccccacgagaaggcgttcgccgccgagcccctc
gccgctgtgctaaacgcgctccaacaagcgccccccaggcccggctgggcggtggcggtg
ctgggcacgggcttcatggcccacctcaccgcccagacactcaccgcctacggcttcaaa
cccgccatagtcgccaggccagacagccccaaagccgtgttcttcaggaggctcgggctt
gaggtcctcacgccggaggaggctgtgaaggcggcctcagagactccaggcggcctaggg
ttccacatggtgttcgagaccacaggcagcaaccaggggctgagcatagccacagccctc
gccagaccccggggcgtagtgcacgtgaagagtaccccaggaggggaggcggtcttcagc
cagaccctagccgtggtgaaggagatcaggctcatcggcacacgctgcggcagccacagg
gagttcaaggaggccctccgcctactcgagtctggagaagttgagccccaggtaacaaag
ttcagaagcctggaggaggctccagaggccttcgaagcatcgctggacagggagagcatg
aagattgtagtcaccatatag

DBGET integrated database retrieval system