KEGG   Aeropyrum pernix: APE_1346.1Help
Entry
APE_1346.1        CDS       T00023                                 

Gene name
acsA
Definition
(RefSeq) acetyl-coenzyme A synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ape  Aeropyrum pernix
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APE_1346.1 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APE_1346.1 (acsA)
   00620 Pyruvate metabolism
    APE_1346.1 (acsA)
   00640 Propanoate metabolism
    APE_1346.1 (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    APE_1346.1 (acsA)
   00680 Methane metabolism
    APE_1346.1 (acsA)
Enzymes [BR:ape01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     APE_1346.1 (acsA)
Lipid biosynthesis proteins [BR:ape01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   APE_1346.1 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(855533..857503)
Genome map
AA seq 656 aa AA seqDB search
MEKKIWYPPRDIVDQSNVKLFMDKHGFKSYEELVRRSSEDLKWFWGNLPEWLGVEWFREP
KAVVDLSRGVEWAQWYRGGLLNAAYNVVDRIVKMGYGHREAFTWVGEDGEVRRYTYLQLK
DEVDRMAKLLSQDYGLGVGDVVAIYAPMMPESIAAMLAAMKVGAVASPIFSGFAPPAVAE
RLKLGEARVLVTVDGYLRRGRRIALKEQADQAVKLAGGAVEHVIVVRRLGIDVPWVEGRD
EWYDRAIAGKAGSAEPEELDPEHPALLLFTSGTTGRPKGAVISHAGAILQPGKEHYFNLD
IHPAWRGGEDRLWWITDIGWMMGPWQVLGSQLLGASHLMAEGAIDYPYKSRVWRLIQEHR
VTHFGFAATVARMLRAVASDTVEDYDLSSIRAFGNTGEPIDHATWMWVMEKLGGWRRPLI
NLSGGTEVFGCILLPSPVVPLKPTTLWGPALGVDADVFDDEGRPVRGEPGYLVVKKPFPS
MTRGLWKDPERYIKTYWSRFPGVWYHGDYALVDEDGFWYILGRADDVIKVAGKRIGSAEL
ESVLTQLPEVAEAACIGVPHPIKGEVIACFLVPKGGYDAEELASKARKAVVDRFGKPFAP
EHVVIVSELPKTRSGKITRRVLRDLARGVEPKELSVLENPEAVEKLRDIIKRIGGG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagaagatatggtatccgccccgcgatatagtggaccagagtaatgtaaagctt
ttcatggataagcacggtttcaagagctatgaggagcttgtcaggaggagcagtgaggac
ctcaaatggttctggggtaacctgcctgaatggctcggggtagagtggttcagagagcct
aaagccgtggtggacctgagcagaggtgtggagtgggcccagtggtaccggggaggcctc
ctcaacgcggcgtacaacgtcgtagaccgtatagtcaagatggggtacgggcatagggag
gccttcacttgggtaggcgaggatggggaggttaggaggtacacgtacctacagctgaag
gacgaggttgacaggatggccaagctcctctcccaggactatgggctgggagtcggcgat
gtggttgcgatctacgcccccatgatgcctgagagcatagcggccatgcttgcggccatg
aaggttggggctgtggcttcaccgatattctccggcttcgccccgccagccgttgctgag
aggctcaagctgggggaggcgagggtgctcgttaccgtagacgggtatctgaggaggggg
aggaggatagccctaaaggagcaggccgaccaggccgtgaagcttgcgggcggggcggtc
gagcacgtcattgtggtcaggaggctcgggatagacgtcccatgggttgagggcagggat
gagtggtatgacagggccatagcgggtaaggctggctctgcggagcccgaggagctagac
ccggagcatccagccctcctcctcttcacaagcggcacaaccgggaggcccaagggcgct
gtgataagccatgcaggcgccatactccagcccgggaaggagcactacttcaacctcgac
atacacccagcctggaggggcggggaggacaggctatggtggataactgatataggctgg
atgatggggccatggcaggtcctcggctcccagctcctgggcgccagccaccttatggcg
gagggggccatagactatccttataagtcgagggtttggaggctaatacaggagcacagg
gtaacccacttcggctttgcggcaacagtggccaggatgctcagggcagtggcgagcgac
acggtggaggattacgacctatcaagcattagggccttcggaaacacgggggagcctata
gaccatgccacctggatgtgggtcatggagaagttgggaggctggaggaggcccctgata
aatctcagcggcgggacagaggtgttcggctgcatactcctcccgagccccgttgtcccc
ctcaagccgacgaccctctgggggcccgctctgggtgttgatgctgacgttttcgacgat
gagggtaggcctgtgaggggcgagccgggatacttggttgttaagaagcccttccccagc
atgaccagggggctgtggaaagaccctgagaggtatataaagacgtactggtcccgcttc
ccgggtgtatggtaccacggcgactacgccctagtcgacgaggacgggttctggtacata
ctggggagggcggacgacgtgataaaagtggcggggaagaggattggcagcgccgagctt
gagagcgtgctcacacagctacccgaagtggcggaggcggcatgcataggggtgccccac
ccgataaagggcgaggtcatagcctgcttcctggtgcccaagggcggttatgacgcggag
gagctggcctcgaaggccaggaaggccgtggtggataggttcggcaagcccttcgccccg
gagcacgtggttatagtgagcgagctcccaaagacgaggagcggcaagataactaggagg
gtgctcagggatctagcccgcggtgtggagccgaaggagctgagtgttctggagaatcct
gaggccgtcgaaaagcttagggacattataaagaggataggagggggctag

DBGET integrated database retrieval system