KEGG   Aeropyrum pernix: APE_1488.1Help
Entry
APE_1488.1        CDS       T00023                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ape  Aeropyrum pernix
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APE_1488.1 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APE_1488.1 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    APE_1488.1 (thrC)
Enzymes [BR:ape01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     APE_1488.1 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944849..945871
Genome map
AA seq 340 aa AA seqDB search
MVDSLGFHLWCPRCGIKLREGEYRPWCPRCRGPLEAVGLPRLPPVLGEGSTPLVEAGEGV
YAKLEYLNPSGSFKDRGVGYSLRMASLLGYDCVVVDSSGNTGLSTALYSARLGLKARVYV
PRGASPGKKALIRATGAELVEAESREEAARLAEAEAEKCFHVAHPTNPLFIEGVKSLGRE
LAGEAAGDTDVLAPVSSGTLLLGIYRGLEEERGRFRLVAVQSPAAYSLKGLVPELGWVGG
VEGRLLDALLLARPPRLEEMARAVRESGGGVVVVGDGAIPGAVREAVQRGFLVEPSSAAV
FAAHEVLREKKWLSGRSLLVLTGSGLKYASLLEKLAAEAA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttggtagactctcttggattccacctctggtgcccccgttgcggtatcaaactcagagag
ggggagtacaggccctggtgcccccgctgtagaggccctcttgaagctgtggggcttccc
cggctgccgcctgtgctgggggagggttcgacgcccctcgtggaggctggtgagggggtc
tatgctaagctcgagtatctaaacccgtcgggcagcttcaaggataggggtgtgggctat
agcctgaggatggctagcctgctggggtatgactgtgttgtggtggattccagcggtaac
acgggtttgagcaccgccttgtacagcgccaggctgggcttgaaggccagggtgtatgtt
ccccgcggtgcttcgccgggtaagaaggcgttgatcagggctactggagcggagcttgtc
gaggctgagagcagggaggaggctgcgcggctggcggaggctgaggcggagaagtgcttc
cacgtcgcccacccaactaaccccctcttcatcgagggtgtgaagagccttggaagggaa
ctggcgggggaggcggcaggcgatactgatgtgcttgccccggtcagcagcggcacccta
ctcctcggcatctacagggggcttgaggaggagaggggccgtttcaggcttgttgccgtc
cagtcgcccgcagcctactccctcaagggtctagttccagagctaggctgggtggggggt
gtggagggcaggctgctcgacgccctcctcctggccagaccgcctaggctcgaagagatg
gcccgcgcggtgagggagagtggtggtggcgttgtggttgtgggcgatggtgctataccc
ggcgcggtgagggaggcggtgcagaggggattcctcgttgagcctagcagcgcagccgtc
ttcgcggcgcatgaggtcctcagggagaagaagtggctttctgggagaagcctcctggtg
ctgactgggagcgggttaaagtatgcgagcctgcttgagaagctcgcagcagaggcggct
tag

DBGET integrated database retrieval system