KEGG   Aeropyrum pernix: APE_1538.1Help
Entry
APE_1538.1        CDS       T00023                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ape  Aeropyrum pernix
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APE_1538.1 (tpiA)
   01230 Biosynthesis of amino acids
    APE_1538.1 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APE_1538.1 (tpiA)
   00051 Fructose and mannose metabolism
    APE_1538.1 (tpiA)
   00562 Inositol phosphate metabolism
    APE_1538.1 (tpiA)
Enzymes [BR:ape01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     APE_1538.1 (tpiA)
Exosome [BR:ape04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   APE_1538.1 (tpiA)
  Exosomal proteins of bladder cancer cells
   APE_1538.1 (tpiA)
  Exosomal proteins of melanoma cells
   APE_1538.1 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
970493..971164
Genome map
AA seq 223 aa AA seqDB search
MKPVLAVNMKTYSSAFGEGARRLARDAARVAREVDVRVILVAPLINASSLAGVYGDVYIQ
HADPVDLGAHTGYTPVEAAAAEGLRGVMVNHSEHKVTYRHLQAVVSKARSLGLEVLACAD
TPEEAAAAALLRPSMVALEPPELIGTGIPVSQAKPEVITRGVEAVARVAPGVAVLAGAGI
TAGEDARRAVELGAQGVLVASAVMKAKDPHGKMLELAEAMAKP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcccgttctcgccgttaacatgaagacctacagctcagccttcggagagggggct
agacgcctggccagagatgcggcgcgggtagcgcgggaggtggatgtcagggttatactt
gtggcgccattgataaacgcctcctccctggctggggtgtatggcgacgtttacatccag
cacgccgaccccgtcgatctgggggctcacacgggctacacccccgtcgaggccgctgcg
gcagaggggttgaggggggttatggttaaccacagcgagcataaggtaacctacaggcac
ctacaggctgtggtctcgaaggctaggagcctggggctagaggtcctcgcgtgcgccgac
actcctgaggaagccgctgcggctgcgctcctaaggccatccatggtcgccctcgagccg
cccgagctcataggtaccggtatacccgtttcacaggcaaaacccgaggtcataacccgg
ggtgtagaggcagtagcccgtgtagcacccggagttgccgtcctagcaggcgcgggcata
actgcgggggaggatgctaggcgcgctgtagagctcggcgcccagggggtgctcgtggct
agcgcggtgatgaaagccaaggacccccatgggaagatgctggagcttgctgaagctatg
gccaagccctaa

DBGET integrated database retrieval system