KEGG   Aeropyrum pernix: APE_1657.1Help
Entry
APE_1657.1        CDS       T00023                                 

Definition
aldolase class II protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ape  Aeropyrum pernix
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ape00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1048988..1049587
Genome map
AA seq 199 aa AA seqDB search
MFYPPRGPIDKSVMADVAEALKTLYERGLVQAMGGNVSALHNGLVYLSPTRVFRGRLSWM
DVAVMRLDGSVVRGRPSSEWRMHIAIYRRLDGIAAVVHAHPPALLGADSTGLRLNPSLLM
EAEATVGCVAGVPRVKPGTWELAEAVATALEASGCRAAVLRNHGVVAVGRSLWEALDMAE
AVEDLARISLYQRLGGGGV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgttctaccctccaagaggccctatagataagagtgtcatggccgatgtcgcagaggcc
cttaagacactctacgagaggggtctcgtccaggcgatgggaggcaatgtttccgcgctg
cacaacggcctagtctacttatcgccgacgcgtgttttcagaggcaggctgagctggatg
gacgtggcagtcatgaggcttgacggcagtgtagttagggggaggcccagcagcgagtgg
aggatgcacatcgccatatatagacgcctagatggcatcgcggccgtcgtccacgcccac
cccccagccctcctcggggcggactcgacggggcttaggctcaaccccagcctcctcatg
gaggccgaggccaccgtaggctgtgtggcgggggtaccacgggtcaaacctggcacctgg
gagctggccgaggccgtggccactgctctagaagcctccggctgtagagccgcagtgctc
aggaaccatggagttgtggctgtgggtagaagcctctgggaggccctcgatatggctgaa
gcagttgaggacctcgccagaatcagcctgtaccagaggctgggcggcggaggcgtatag

DBGET integrated database retrieval system