KEGG   Aeropyrum pernix: APE_1917Help
Entry
APE_1917          CDS       T00023                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ape  Aeropyrum pernix
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APE_1917
  Amino acid metabolism
   00300 Lysine biosynthesis
    APE_1917
Enzymes [BR:ape01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     APE_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1212850..1214175)
Genome map
AA seq 441 aa AA seqDB search
MAGVVEFLSSLVEVESVNDPSAGRLVGVGEAEEVRRAVREHAGLDMELVENEGVPILLYM
AGSGRPVTLFMAHFDVVPPGPGWRVTEPFKPVVKGGRLYGRGAADDKSNVAAISLALSGF
EPGRGTVIIAFTGDEEIGGERGAGWLAGRLRSEGLWPDYVVNGDGSMGAVITRRRNVFNA
IVRVRAERADAEGVSRRVMRLGLEVRGRPTRHAAYFIPGVDSHPLLTAAALVREAGLLAS
SLSGEWVKSNVLPASVELEALEPGGGGHGVYDPGLTALLKSLIPLSRITPGRLLYSDYGV
TATPNVYRLAEGWHEVIVDVRAMTGDPAAVDEAVARSLEESLGSRVEWEYRVTGGGGYLY
TPSSAELVKLALRVNQSLGLPGEPREAAGASDSRYFSPRGSQAIDYGPLGGNVHGPDEYV
EIRQLEAAVEFYRRVAEALHG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtggctggtgtagtggagtttctttctagtctagttgaggttgagagtgtaaacgaccct
tccgctggtaggctggttggtgttggcgaggccgaggaggttaggcgtgctgtgagggag
catgcagggcttgacatggagcttgtggagaatgagggcgtgcccatactcctctacatg
gcgggctcggggaggcctgtaaccctcttcatggcccacttcgacgtggtccccccgggg
ccagggtggagggttaccgagcctttcaagcccgtggttaagggtggcaggctctacggc
aggggcgctgctgacgataagtccaacgtggccgccatatccctcgccctctccggcttc
gagcccggccgcgggactgtcatcatagctttcacaggggatgaggagataggcggggag
aggggtgctgggtggctggcggggaggctcaggtctgagggtttgtggcctgactatgtt
gtcaatggcgacgggagcatgggggcggtgataactaggaggaggaacgttttcaacgcc
atagtaagggttagggctgagagggctgacgccgagggtgtttcgaggcgtgttatgagg
ctgggtctggaggtgagggggaggccgacgaggcacgcagcctacttcatacccggcgtc
gacagccaccccctactaaccgcggccgccctggtcagggaggccggcctgctcgcctca
agcctcagcggcgagtgggtgaagagcaacgtcctccccgctagcgtcgagctagaggcc
ctagagcccgggggcggagggcatggtgtctacgaccccggcctaacagccctgctgaaa
agcctcataccactctcccgcataaccccaggcaggctcctctacagcgactacggcgtc
accgccacacccaacgtctacaggcttgcggagggctggcatgaggttattgtcgacgtc
agggccatgaccggggacccggctgctgtcgacgaggcagtggccagaagcctagaggag
agcctcggctcccgtgtggagtgggagtacagggttaccgggggagggggctacctctac
acccccagcagtgcagagctggtcaagctcgccctaagggtgaaccagtccctaggcctc
cccggggagccccgggaggcggccggggccagcgacagcaggtacttcagcccgaggggc
tcccaggccatagactatggacccctcggggggaacgtgcacggccccgacgagtacgtc
gagataaggcagctggaggccgctgtagagttctacaggcgagttgcagaggcgctccac
ggctag

DBGET integrated database retrieval system