KEGG   Aeropyrum pernix: APE_2041.1Help
Entry
APE_2041.1        CDS       T00023                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ape  Aeropyrum pernix
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APE_2041.1
Enzymes [BR:ape01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     APE_2041.1
Peptidases [BR:ape01002]
 Cysteine Peptidases
  Family C44
   APE_2041.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1284410..1285366
Genome map
AA seq 318 aa AA seqDB search
MSWSLCRGYALRLAEIVARESRGCGCITLSGGIDTSFVAAVHPKRRVLRAFTVDLGGSDV
RYARLAAERLGLKDHIIVNPGLDDFSKAVDWVLRSMEVIDPVEVAASSIHYIALSAAAGE
GCGCVLSGDGGDELFLGYSFLLDKSIGYLEEWRRRMAREARLPTVEVARMLGVDVIAPLY
SRESRRLALETPLECLVKGRWGKWMIRMLLDELGLREIAFRDKAPVTEGSGSLAALKSLA
TAMGGGEGAGAGLDFNPPTMLHSFLAHRLKNLKGRLPPKASQEKRACPVCGRELRRGWCR
FCGATVSPQGVATHYTGD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgagctggagcttatgcagggggtatgcattgaggcttgcagaaatagtggctagagag
tcgagggggtgcggatgtataacactctccggcgggatagacactagcttcgtagccgcg
gtacaccctaaaaggagggtgctaagggcgttcaccgtggatctgggtgggagtgacgtt
cgctacgccaggcttgcggcggagaggctgggtttaaaggaccatatcatagttaatccc
ggtctcgacgatttctccaaagctgttgactgggtcttaagatccatggaggttatagac
ccggtcgaggtagcagcctcgtcgatacactatatagccctttcagcggcggcgggggag
ggctgcggctgcgtcctgtctggcgatggcggcgacgagctcttcctaggctatagcttc
ctgctagacaagagtattgggtatctggaggagtggaggaggcgtatggcgagggaggcg
aggctacccacagtagaggttgccaggatgcttggagtagacgtcatagcccctctctac
agccgggagtctaggaggctggcgcttgagacgccgttggagtgtcttgtcaagggtaga
tggggtaagtggatgatcaggatgctgctagacgagctaggcttgagggagatagcattc
agagataaagcccccgtgacagaggggtccggatctctggcggccctaaagtccctggct
acagccatggggggcggcgagggagcaggagccgggctggacttcaaccctcctactatg
ctacactctttccttgcccacaggctcaagaacctcaagggccgcctccccccgaaggcc
tcgcaggagaaaagagcgtgcccagtctgtggaagagagcttaggagggggtggtgcagg
ttctgcggagctaccgtctcaccccaaggcgttgctacacactatactggtgattag

DBGET integrated database retrieval system