KEGG   Aeropyrum pernix: APE_2091.1Help
Entry
APE_2091.1        CDS       T00023                                 

Definition
ATP-dependent glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ape  Aeropyrum pernix
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APE_2091.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APE_2091.1
   00052 Galactose metabolism
    APE_2091.1
   00500 Starch and sucrose metabolism
    APE_2091.1
   00520 Amino sugar and nucleotide sugar metabolism
    APE_2091.1
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    APE_2091.1
   00524 Butirosin and neomycin biosynthesis
    APE_2091.1
Enzymes [BR:ape01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     APE_2091.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1320081..1321043)
Genome map
AA seq 320 aa AA seqDB search
MAEVVAVDVGATWVRMAIVRGGVIEAIKRERNPGTEEGLERVLQGLAEGLGIDRGRVEKV
GAASIGPLDLRRGYIVGSPNIKSHIVRLSTILKRLFPKSKVAIANDAVAAAWGEYLLGRL
AGTPDLGYITMSTGVGGGFVVGGRLLLGSRGNAHEVGHIVVDMGWEGGRCGCGGTGHWEA
IAGGRWIPRTSSVLARGWRGPETSLYRAALEGRVGSAREVFEAAAVGDDFALHVIDYIAR
ASAAGIASVKAAYDVDAVIIGGSVYLNNRRMLRPLIERHLAAYAPFSSRIEVVDASFGDN
EGVMGAYAIAYRNPEDLPIF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaggttgttgctgtagacgtgggtgccacgtgggttaggatggccatagttagg
ggaggggttatagaggctatcaagagagagcgtaaccccggtaccgaggaaggtttagag
cgtgttctccagggccttgccgaggggctaggcatcgatagggggcgggtcgagaaagtg
ggggccgcttcaataggccccctggaccttcggaggggctacatagtgggcagcccgaat
atcaagtcgcatatagtccgtctaagcactatactcaagcggctgttccccaagtcaaag
gttgccattgctaacgacgcagtagcggcggcgtggggcgagtatctgctgggcagattg
gcaggcacacccgacctggggtacataaccatgagcaccggcgtgggaggaggcttcgta
gtcggcggcaggctcctactgggctcccgggggaacgcccacgaggtgggccacatagtc
gtcgacatgggctgggagggcgggaggtgcgggtgcggcggcacgggtcattgggaggcg
atagcgggggggaggtggataccgaggacctcctcggttctagccagaggctggaggggt
cccgagactagtctgtacagggcggcgttagaggggagggtggggagcgctagggaggtg
tttgaggcggccgccgtgggcgacgatttcgcgctccacgttatagactatatagccagg
gcgtcggccgctggtatagcctcggttaaggctgcctacgacgtcgacgcagtcataata
ggaggctcagtctacctgaacaacaggcggatgctcaggccgcttatagagaggcatcta
gcggcctacgcccccttctcgtccaggatagaggttgtggatgcgagcttcggggataac
gagggtgtaatgggggcctacgcaatagcctatagaaaccccgaggacctcccaatcttc
tag

DBGET integrated database retrieval system