KEGG   Aeropyrum pernix: APE_2106.1Help
Entry
APE_2106.1        CDS       T00023                                 

Definition
ATP-dependent 6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ape  Aeropyrum pernix
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    APE_2106.1
Enzymes [BR:ape01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     APE_2106.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1329354..1330274
Genome map
AA seq 306 aa AA seqDB search
MQTHIAVGNINLDISLSVDRLPGPEEVVFARDAWIGVGGAATNYAIAVAQLGQKPVLVAV
AGREMERLGVVDTLRRRGVDVSRVKTVDRPSGVVVVMVVASDSHRSMVSMRGANEELLKY
IEEEPLDGVSGECHVHMASVPPQALDFAPGGCTLSYDPGGEAFKRPKSLWSRLPRVDWMF
INTPELKGMSGSGDLAAAYRLLESGLKRLVLKHGRGGATVVERGFCVTLDRTPVLEPVDV
TGAGDAFDAAFNIAVKAGWSVEEALRLAVAAGSAKVLRRGSSNMPTASEVLAMLPRVAYP
RDCSLT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgcagacgcacatagcggtgggcaacatcaacctagacataagcctctccgtcgacagg
ctgccgggccctgaggaggtagtgttcgccagggacgcgtggataggcgtgggcggcgcg
gcgacgaactacgccatagcagtagcccaactgggccagaaacccgtgcttgtggcggtt
gccgggagggagatggagaggctgggtgttgttgacacgcttaggagacggggtgtggac
gtatccagggtgaagaccgttgataggccctcgggtgttgtcgttgtcatggttgtagcc
agcgactcgcacaggagtatggtgtcgatgaggggggccaacgaggagctcctcaagtat
atcgaggaggagccccttgatggtgtctcgggcgaatgccacgttcacatggccagcgtg
ccaccccaggctctggacttcgcccccgggggttgcaccctcagctacgacccggggggc
gaggctttcaagaggccgaaaagcctgtggagcaggctcccccgggttgactggatgttc
ataaacactcctgagcttaagggtatgagcggcagcggcgacctggccgcggcctatagg
cttctagagtcggggttgaagaggcttgtgttgaagcatggtagaggcggtgccacggtc
gtggagaggggtttctgcgtaacgctggaccggacgccagtgctggagcccgttgacgtg
accggagcgggagacgccttcgacgctgctttcaacatcgcggtgaaggctggctggagc
gttgaggaggctttaaggctggcagtggccgcaggctcggcaaaagtgcttaggaggggt
agcagcaacatgcctacggccagcgaggtcctcgccatgctacccagggtagcctatcca
cgggattgcagcctaacctag

DBGET integrated database retrieval system