KEGG   Aeropyrum pernix: APE_2286Help
Entry
APE_2286          CDS       T00023                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ape  Aeropyrum pernix
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APE_2286 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APE_2286 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    APE_2286 (thrC)
Enzymes [BR:ape01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     APE_2286 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1459944..1461125)
Genome map
AA seq 393 aa AA seqDB search
MACGSKYPSSPRLFTCPKCGGLLEPFYIDGGSPRGRGVWRYRDLLPRPRRIVTMGEGSTP
LVKLENLSRAMGVEVYGKLEFLNPTGSFKDRGMTVGVSIASSFSYRLVVAASTGNTAASM
AAYARRAGLNPVILIPKGGIASGKLSQIAALGAWVLEVEGSFDDALDAARAAAEKGLAYS
LNSINPYRLEGQKTIAFEILEDVDRVDHVVVPVGNAGNISAIWKGFKEAGLLGLPSMRPR
MVGVQAEGASPLYRAWVEKMDSVERVRNPSTIASAIRIGNPVNAAKALAAVRESDGLIIS
VSDAEILKAAATLAENEGMLVEPASAASLAGLIKLRNQGIIASGSSVVLILTGHGLKDPR
ALEFIASSAGVRRAYASTAEEALLKLEEIAVGG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggcctgcggctccaaatatccgtcctcccctcgtctattcacctgccctaagtgcggg
gggcttctggagcccttctacattgacggaggatcgcccaggggcaggggggtgtggagg
tatagggacctcctgccgaggccacgcaggatcgtgaccatgggggagggttctacgccg
ctggtcaagctggagaacctttctagggctatgggggttgaagtctatgggaaactcgag
ttcctaaaccctactggcagctttaaggataggggtatgactgttggtgtcagcatcgcc
tcgtccttcagctaccgacttgtagtagcggcaagcacgggtaacactgcggctagcatg
gcagcatacgctaggagagcagggcttaatccggttatactgattccgaaggggggtata
gcctcgggcaagctctcccagatagccgcccttggggcttgggttcttgaggttgagggc
agcttcgacgatgctctcgacgctgccagggccgctgcggagaaggggctcgcgtactca
ctcaacagcataaacccctacaggcttgaggggcagaagaccattgccttcgagattcta
gaggatgtggacagagtggaccatgtggtggtgcctgtgggtaatgcgggtaacatatct
gcaatatggaaagggttcaaagaggccggcctcctaggccttcccagcatgaggcctagg
atggtgggggtccaggctgagggcgcctcccccctgtacagggcttgggttgagaagatg
gactctgtggagagggttagaaacccgagcaccatagcctcggccataaggataggcaat
ccagtcaacgctgcgaaagccctggcagcggttagggagtcggacggtttaataatatct
gtcagcgacgccgagatcctaaaggcggcggccacgctcgctgagaacgaggggatgctg
gtagagcctgccagtgcagccagccttgcaggcctcataaagctgaggaaccagggcatc
atagcttctggctcaagcgtggtgctgatactcacaggccacggtcttaaggatcctagg
gccctagagtttatagcaagtagtgcgggtgtaaggagagcatatgccagcaccgccgag
gaggctctactcaagctggaagagattgctgttggcggttag

DBGET integrated database retrieval system