KEGG   Aeropyrum pernix: APE_2316Help
Entry
APE_2316          CDS       T00023                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ape  Aeropyrum pernix
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APE_2316 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APE_2316 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APE_2316 (trpB)
Enzymes [BR:ape01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APE_2316 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1481572..1482921)
Genome map
AA seq 449 aa AA seqDB search
MDLARYRFDLSIEEVPTSWYNILPDLPEEVPPPLNPKTGEPVDPSALAKLFPKALIEQEV
SRERYIEIPGEVHEAYISFARRPTPLLRAVNLERALNTPAEIYYKYEGVTPTGSHKINTA
LAQAYYNKLEGVERLVTETGAGQWGSALSAAGAYFGVKVRVYMVRVSYLQKPYRRTLMEL
YGAEVYPSPSDKTEFGRKLLAENPNHPGSLGIAISEAIEDVINSGGNAKYSLGSVLNHVL
LHQTVIGLEAEKQFREAGVYPDIMIGAVGGGSNFAGFTYPFIRHRLKGSSSTRFIAVEPK
ASPSMTRGVYTYDYGDTAGLTPLLKMHTLGHTYQVPPIHAGGLRYHGVAPTLSVLLKHGI
VEARAYHQREVFRAAHMFAKAEGIVPAPESAHAVKAAIDEAIKARDEGRRVVIAFNLSGH
GLLDLQGYREYLDGTLEDYEPEEIPASRR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggatttagctaggtacaggttcgacctctccatagaggaggtccccacatcctggtac
aacatcctcccagacctcccagaggaggttcctccccctctgaaccccaagacaggggag
ccagtggacccgtcagccctcgccaagctctttccaaaagcgttgatagagcaggaggtc
agtagggagaggtatatcgagatacccggcgaagtccacgaagcctacatatcgttcgcc
aggaggccaacccccctccttagagcagttaacctggagagagcgctgaatacgcccgcg
gaaatctactataagtacgagggtgtaacccccacggggagccacaagataaacacggcg
ctagcccaagcgtactacaacaagctggagggggttgagaggctggtcaccgagactgga
gccggccaatgggggtcggccctctcagccgctggagcctacttcggcgtgaaggttaga
gtgtacatggtgagggtgagctacctccagaagccctataggcggacgctgatggagctt
tacggggctgaggtctacccgagcccaagcgataaaacagagtttgggagaaagcttctc
gccgagaaccccaaccaccctggaagcctggggatagcgataagcgaggctatagaggac
gttatcaacagcggtggtaacgctaagtacagcctaggcagcgtgcttaaccatgtcctc
ctccaccagacagtgataggccttgaggctgagaagcagttcagagaggcgggtgtctac
ccagacataatgataggcgccgtgggcgggggcagcaacttcgcgggcttcacctacccc
ttcataaggcacaggctaaagggctcaagctccaccaggttcatagcggtagagcctaag
gcaagccctagcatgacgcggggagtctacacgtacgactacggcgatacagcggggctc
acacccctcctcaagatgcacaccctaggccacacataccaggtcccccctatacacgcc
ggggggctgaggtaccacggtgtagcgcccactctaagcgtgcttctaaagcacggcata
gtggaggcgagggcctaccaccagcgagaggtgttcagggcggcacacatgttcgcgaag
gcagagggtatagtgccggctcctgagagtgctcatgcggtgaaggccgcgatagacgag
gcaatcaaggcgagggatgagggtaggagggtagtgatagctttcaaccttagcggccac
ggcctcctagatctacaaggctatagggagtacctagacggtacacttgaggactacgag
cctgaggagatacctgcgtcgagaaggtga

DBGET integrated database retrieval system