KEGG   Aeropyrum pernix: APE_2546Help
Entry
APE_2546          CDS       T00023                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ape  Aeropyrum pernix
Pathway
ape00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ape01100  Metabolic pathways
ape01110  Biosynthesis of secondary metabolites
ape01130  Biosynthesis of antibiotics
ape01230  Biosynthesis of amino acids
Module
ape_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APE_2546 (trpC)
Enzymes [BR:ape01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     APE_2546 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DHO_dh His_biosynth NanE FMN_dh PA ThiG IMPDH Dus
Motif
Other DBs
NCBI-ProteinID: BAA81563
UniProt: Q9Y8T7
Position
complement(1619360..1620145)
Genome map
AA seq 261 aa AA seqDB search
MRDSFLQKAIASAKDRTSLLEEIAGNCSPKPGRPSLSSSIREWVYRVGGAVIAEYKRCSP
SAGAISTLDPVSYVQATRDASAAYSVLTEPNWFCGSIELIPYFARYKPVLAKDFIVSETQ
IRIAACMGASAALLIMEALTPRELQELAAAASRYGVEVLVETPDASHAVEASRLAPGSII
GVNSRDLKTLRVDYEAMLREVSKAREQLPGEVILVAESGIDSPDKALKAFKAGAQAILVG
TAFMKNPQLREKILAELLQIP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagagatagcttcctgcagaaggcaatagccagtgcgaaggacaggacctccctgtta
gaggaaatcgcggggaactgtagccccaagcctggtaggcctagcctctccagctcgata
agggagtgggtgtaccgtgtaggcggagcggtaatagccgagtacaagaggtgtagccct
tccgctggtgcaatatccacccttgatccagtgagctatgtacaagccactagagatgcc
tcggccgcatatagcgttctaacagagccgaactggttctgcggaagcatagagttaata
ccctacttcgccaggtacaaaccggtccttgccaaggacttcatagtgagtgaaacccag
atcaggattgcagcctgtatgggagcatcggcggcgctcctaataatggaggcactaacc
ccgagagaacttcaggaactcgcagccgctgcctccagatacggtgtcgaagtgctagtt
gaaacgcccgacgccagccacgctgtcgaggcttctaggcttgcccctggatcgattata
ggggtgaacagcagagatctgaaaacactcagggtggactatgaagctatgttgagagag
gtctccaaggccagagaacagctgccgggagaagtgatactagtagctgaaagcgggata
gactctcccgataaagcacttaaggctttcaaagcaggggcacaagccattctcgtaggg
acagccttcatgaaaaaccctcagctacgggaaaaaatattggcagaactcctccagatc
ccctag

DBGET integrated database retrieval system