KEGG   Aeropyrum pernix: APE_2548Help
Entry
APE_2548          CDS       T00023                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ape  Aeropyrum pernix
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APE_2548 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APE_2548 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APE_2548 (trpB)
Enzymes [BR:ape01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APE_2548 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1620783..1622066)
Genome map
AA seq 427 aa AA seqDB search
MVSVPLRWYNIAADLPEPLPPLRDPEGLREESRIALLSRILPSRLIEDEYILARWVDIPG
EVRKALARIGRPTPLIRAEGLEKVLGVKGRVRIYYKSEAVLPTGSHKINTAIAQAYYAKL
DGAKEIVTETGAGQWGLAASTAAALMGLKATVFMTASSFKSKIQRRLLMEAQGARVISSP
SKLTDTGREALEEYGSTHPGSLGLAIAEAVEYTLESGDRRYLPGSVLEAVLMHQTVIGLE
ALDQLPEEPDVVVACVGGGSNFGGFTYPMIGARLRGEGFEKTRFIAAESTAAPKLTRGEY
RYDGLDSSLILPLAKMYTLGHRYTPPPSHAAGLRYHGVSPSLSILRRLGLVEAEAIPQEE
ALASILLMARSEGVVPAPESSHAVALAARIARKLPDGSVVAFNLSGHGLLDLDALQKALE
IRGASMW
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcagttccccttagatggtataatattgccgccgacctgccggagccgctgcct
cctttaagggatcccgaggggttgcgggaggagagtaggatcgctctcctctcgaggatc
ctgccgtctaggttgatagaggatgagtacatcctggcgaggtgggttgacattcccggc
gaggtgaggaaggcactagccaggattggcaggcctacccctctcatcagggccgaaggg
ctggagaaggtcctcggggtgaaaggtagggttcggatatattataagagtgaggccgtt
ctacctacggggagccacaagattaacacggccatagcccaggcctattacgctaagcta
gacggagctaaagagattgtgacagaaactggagcaggccaatgggggttagcggcctcc
actgccgcagcattaatgggtttgaaggctacagtgttcatgactgccagcagcttcaag
tcgaagatccagaggagacttctcatggaggcccagggcgctagagtgatctctagcccg
agcaagcttactgacacaggcagggaggccttggaggagtatggtagcacccacccgggt
agccttggccttgctatagcagaggctgtggagtacaccctggaatcaggggaccgacgc
tacctacctgggagcgtgctggaggcagtccttatgcaccagaccgtcataggcttagag
gctctggatcagctccccgaggagcctgacgttgttgtagcgtgtgtgggagggggcagc
aactttggaggcttcacataccccatgataggggcccggctcaggggcgaaggctttgag
aagacaaggttcatagcggctgagagcaccgccgcgccgaagctcacaagaggcgagtac
aggtacgacggcctagactccagcctcatcctccccctagcgaagatgtacactctagga
caccgctacactccacctcccagccacgcagcgggcctccgctaccacggggtgtccccg
agcctcagcatcctacgccgtctcggcctggttgaggcggaagcaataccccaagaggag
gctctcgcgtcaatactgcttatggcgcggagtgagggggtggtcccagcccctgagagc
agccatgccgtcgcgttggctgccagaatcgctagaaaactgcctgatggttctgtagtc
gcgtttaaccttagcggccacggcctcctagatctggacgcccttcagaaggctttagag
ataagaggtgcttctatgtggtga

DBGET integrated database retrieval system