KEGG   Aeropyrum pernix: APE_2550Help
Entry
APE_2550          CDS       T00023                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ape  Aeropyrum pernix
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APE_2550 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APE_2550 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APE_2550 (trpA)
Enzymes [BR:ape01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APE_2550 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1622072..1622830)
Genome map
AA seq 252 aa AA seqDB search
MAIARPGFSVYLTIAWPSPDTFLEIASTLKGCVDYLELGIPTPKPLYDGPTIRLTHLKAV
ESGYSGPKTLSLAEEASQEAGVPYIVMAYATEQPWSFSEVLREASRKGALSVLPPDLPFE
LPGHVEWYVEESRRLGMEPSLFASPKFPHRWLDRYRRLDPLLIYLGLQPATGVKLPLAFL
RNVKTARKIVGQVYMLAGFSIKSPEDALRVLEAGADAVVVGSEVARLVSSGRLGEARHLA
CSIRAAISERGG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctatagctaggcccggcttttcagtgtacctcacaatagcctggcctagccccgac
acgttcctcgagatcgcctcgaccctgaaaggttgtgtagactatctggagctaggaata
cccacgcccaagccgctctacgacgggcctaccataaggctcacacacctcaaagcagtc
gagtccggctactcagggccaaaaaccctcagcctagccgaggaggcttctcaagaggcc
ggagtcccatatatagtgatggcctacgccaccgaacagccgtggagcttcagcgaagta
ctgagggaagcttccagaaaaggggcattaagcgttctccctccggacctccccttcgag
ctgcctggccatgtggaatggtacgttgaggagtctaggcggctcggcatggaaccgagt
ctcttcgcctcacccaaattcccacaccgctggctagacaggtataggagactggaccct
ctcctcatatacctgggccttcagccagctacaggggtgaagctgccactagcctttctg
cgcaacgtgaagactgctaggaagatagttgggcaggtgtacatgctagccggcttcagc
atcaaaagccctgaagacgctctaagggtcctagaggcgggtgcagacgccgtcgttgtg
ggatcagaagttgcacgcctagtctcgtccggcaggctaggggaggctcgccacttagcc
tgtagcatacgcgcagccataagtgagagaggtggctag

DBGET integrated database retrieval system