KEGG   Aeropyrum pernix: APE_2604Help
Entry
APE_2604          CDS       T00023                                 

Gene name
acsA
Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ape  Aeropyrum pernix
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APE_2604 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APE_2604 (acsA)
   00620 Pyruvate metabolism
    APE_2604 (acsA)
   00640 Propanoate metabolism
    APE_2604 (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    APE_2604 (acsA)
   00680 Methane metabolism
    APE_2604 (acsA)
Enzymes [BR:ape01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     APE_2604 (acsA)
Lipid biosynthesis proteins [BR:ape01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   APE_2604 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1656088..1657629)
Genome map
AA seq 513 aa AA seqDB search
MLAVTRIGAIHSVVFSGFSSWALADRIVDAKADVLITADGFYRRGRIVDLKKNADEAVKL
AADNGVKVRKVIVVRRAGNEVRWSSELNVWYHDLLKEVPEKVYVKPEPRKSDDVLFILYT
SGTTGKPKGIMHSVGGYMTYVYNVFRWNWDPRPEDVFWTAADIGWITGHTYIVYGPLMHG
ETQIMYEGAPDYPNPGRIWEMVERYGVTVFYTSPTLLRLLRKYGDEWVEGRDFSRLRLLG
TVGEPINPEVWKWYYEKIGWKRAPIVDTWWQTETGAAMISPAPGIALVPLKPGSATLPLP
GIVADVLTSDGRQAGPGEKGYLVVREPWPGMMLGIWGDPDRYVRTYWSRFSKPEEGVWIY
YPADYAVRDRDGYFWILGRADEVLNVAGHRIGTIELEDALLTHPAVSEAAVVGAPDPVKG
EVPVAFVVLRAGYEPSDKLERELRETVRRLIGPIAEPSKIYFVEKLPKTRSGKIMRRIMI
SLLRGQPVGDVTTLEDPSAVEAVRRALEREKAG
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgctagccgtgacaagaatcggggccatacacagcgtggtattctcggggttcagcagc
tgggccctcgccgacaggattgtcgacgccaaggcggatgtcctgataacggcggatggc
ttctataggagggggaggatagttgatctcaagaagaacgccgacgaggccgtgaagctt
gccgccgacaatggtgtaaaggttaggaaggttatagtggtgaggagggctgggaacgag
gttaggtggagcagcgagctgaacgtctggtaccacgacctcctgaaggaggtgcctgag
aaggtctatgtaaagccggagccgaggaagtctgacgacgtgctcttcatactatacacc
agcgggacgacgggaaagcctaagggtataatgcacagcgtaggcggttacatgacctac
gtctacaacgtgttccgctggaactgggatccgaggcccgaggacgttttctggaccgcc
gcggatataggctggataacgggccacacctacatagtctacggcccgttgatgcacggc
gagacccagatcatgtacgagggggctccagactatccgaaccctggtaggatctgggag
atggtggagcgctacggagtaacggtcttctacactagccccacccttctcaggctgctc
aggaagtatggggacgagtgggttgagggcagagacttctcccggctaaggctactgggt
actgtgggggagccgattaaccccgaggtgtggaagtggtattacgagaagataggctgg
aagagggctcccatagtggatacgtggtggcagaccgagacgggggcggcaatgataagt
cccgcgcccgggatagcgctggtccccctgaagccgggcagcgctacgctcccgctacct
gggattgtggctgatgtcctgacaagtgacgggaggcaggcagggccgggtgagaagggc
tacctggttgtgagggagccgtggcccggcatgatgctgggtatatggggagatcctgat
aggtatgtgaggacctactggtccaggttcagcaagccggaggagggggtttggatctac
tatcccgcggactatgctgtgagggatcgcgacggctacttctggattctaggtagggct
gacgaggtcctcaacgtggcgggacacaggattggaactatagagcttgaggacgccctc
ctcacacaccccgcggtgagcgaggcagccgtggtgggggcgcccgatcccgttaagggt
gaggttcccgtggccttcgtcgtccttagggctggctacgagccgagcgataagctggag
cgggagcttagggagacagtgagaaggctgataggccctatagcggagccgtcaaagata
tacttcgtggagaagctcccgaagactaggagtggtaagataatgaggaggattatgata
agcctgctacgaggccagcctgttggagacgtcaccacgcttgaggacccaagcgctgta
gaggctgtaaggagagcccttgagagggagaaggctgggtag

DBGET integrated database retrieval system