KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_00320Help
Entry
APA03_00320       CDS       T01812                                 

Definition
succinate dehydrogenase membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:apf01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:apf00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:apf00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:apf00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29110..29523
Genome map
AA seq 137 aa AA seqDB search
MNASAPHIEVMRSQLGRARGLGAGHSGVGHWWAERVTAASLLPLSTWFVVQMFRLGGADH
TEVVKWGGKPVNATMLIALIITTFYHAQLGLQVIVDDYVHGKAHLPTRLLVKIGTSLLGL
LGVIAVIKLFVRGSTAK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttctgctcctcatattgaagtcatgcgctcccagcttgggcgggcacgcggg
ctcggggccgggcattccggtgtaggccattggtgggccgaacgtgtaacggcagcttcc
ttgcttccactttcaacgtggtttgtggtgcagatgttccgccttggcggcgcagatcat
acagaagtggtgaagtggggcggcaagcccgtaaacgcgaccatgctgatcgccctgatc
atcaccactttctaccatgctcagcttgggctgcaggtcattgtggatgattacgtgcac
ggcaaggcgcatctgcctacccgcttgcttgttaaaatcggtacctccttgttggggctg
ctgggcgtaattgccgttatcaagctgtttgtgcgcggtagcactgccaaataa

DBGET integrated database retrieval system