KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_00320Help
Entry
APA03_00320       CDS       T01812                                 

Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
apf00020  Citrate cycle (TCA cycle)
apf00190  Oxidative phosphorylation
apf00650  Butanoate metabolism
apf01100  Metabolic pathways
apf01110  Biosynthesis of secondary metabolites
apf01120  Microbial metabolism in diverse environments
apf01130  Biosynthesis of antibiotics
apf01200  Carbon metabolism
Module
apf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA03_00320
   00650 Butanoate metabolism
    APA03_00320
  Energy metabolism
   00190 Oxidative phosphorylation
    APA03_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS CPT
Motif
Other DBs
NCBI-ProteinID: BAI01240
Position
29110..29523
Genome map
AA seq 137 aa AA seqDB search
MNASAPHIEVMRSQLGRARGLGAGHSGVGHWWAERVTAASLLPLSTWFVVQMFRLGGADH
TEVVKWGGKPVNATMLIALIITTFYHAQLGLQVIVDDYVHGKAHLPTRLLVKIGTSLLGL
LGVIAVIKLFVRGSTAK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttctgctcctcatattgaagtcatgcgctcccagcttgggcgggcacgcggg
ctcggggccgggcattccggtgtaggccattggtgggccgaacgtgtaacggcagcttcc
ttgcttccactttcaacgtggtttgtggtgcagatgttccgccttggcggcgcagatcat
acagaagtggtgaagtggggcggcaagcccgtaaacgcgaccatgctgatcgccctgatc
atcaccactttctaccatgctcagcttgggctgcaggtcattgtggatgattacgtgcac
ggcaaggcgcatctgcctacccgcttgcttgttaaaatcggtacctccttgttggggctg
ctgggcgtaattgccgttatcaagctgtttgtgcgcggtagcactgccaaataa

DBGET integrated database retrieval system