KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_00540Help
Entry
APA03_00540       CDS       T01812                                 

Gene name
recR
Definition
DNA recombinase RecR
Orthology
K06187  
recombination protein RecR
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:apf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54407..55003
Genome map
AA seq 198 aa AA seqDB search
MGGQEIEQLIRLLGRLPGFGPRSARRVALYLLKEPQTRLAPLAHAMERAGNAIKTCSSCG
NLDTIDPCHICSDPLRDQGLICVVETVGDLWALERAGVHRGVYQVLGGTLSPLAGIGPED
LDVAPLFEKLNKGTVREIILALGATVEGATTMHWLMDQLAPYGGVTVSRVAQGVPMGGAL
DVLDDGTLAAALGARRPA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggcaggaaatagagcagcttatccggcttttgggccggttgccggggtttggc
ccgcgttctgcgcgcagggttgcgctgtatttgctgaaagaaccgcaaacccggcttgcg
cctctggcgcacgcaatggagcgggcaggcaatgccataaaaacctgctcatcctgcggt
aatctggatacgatagatccatgccatatctgctctgatcctttgcgagatcagggtttg
atctgtgttgtggaaacggtgggtgatctgtgggcgctggagcgtgctggtgtgcatcgt
ggagtgtatcaggttttaggcggcacactctctccgttggcgggtattgggccggaagat
ctggacgtagccccgctgtttgaaaagctgaacaaaggcacagtgcgcgaaattattctg
gcattaggcgcaacggtagaaggggccaccaccatgcattggctgatggatcagcttgcg
ccttatggtggtgtaaccgtcagccgtgttgcgcaaggcgtgcccatgggtggggcgctg
gatgtgctggatgatggcactctggccgcagcgctaggcgcacggcgccctgcatga

DBGET integrated database retrieval system