KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_03110Help
Entry
APA03_03110       CDS       T01812                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APA03_03110
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APA03_03110
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APA03_03110
Enzymes [BR:apf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APA03_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323568..324887
Genome map
AA seq 439 aa AA seqDB search
MTGDVRLLHIWQARFFTRYGSGRPEMADPKEHGTSAVHSNSLRHQPDERGHFGGRHGGRF
VAETLMPLILELDEAYKVAKADPAFRKELDYYLKDYVGRPSPLWFAQRMTEELGGAKIFL
KREELNHTGSHKLNNVMGQILLARRMGRTRIVAETGAGQHGVATATVCALFGLKCVIYMG
ATDVERQKPNVFRMRLLGAEVVPVTSGAGTLKDAMNEAMRDWVANIADTYMLIGTVAGPH
PYPAMVRDFQSVIGTETKAQMKAAEGRLPDVVVAAIGGGSNAMGIFYPFLDDKSVRLIGV
EAAGHGLDSGKTAASIERGRPGVLHGNRTYLLQNADGQIEEAHSISAGLDYPGVGPEHSW
LHDIGRAEYVGITDNEALDAFQFCTRMEGIIPALESAHAVAYAAKIAPTLSKDTLLVVNL
SGRGDKDIFTVAEHLGVKL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgatgtcaggcttttacatatctggcaggcgcggtttttcacgcggtatggg
agcggcagaccagaaatggcagatccgaaggaacacggcacgtcagcggtgcatagcaat
tccctccggcaccagccggatgagcgggggcattttggtgggcgtcatgggggccgtttt
gtagcggaaacccttatgcccctcattctggaactggatgaggcctataaggtcgccaag
gctgatccggctttccggaaggagctggattattatctgaaagattatgtcggccgcccc
agcccactctggtttgcccagcgcatgacggaagaattgggtggcgctaaaatttttctt
aagcgtgaagaactcaatcatacgggctcacacaagctcaataacgtcatggggcagatt
ttgctggctcggcgtatgggtcgcacccgtattgtggcggaaaccggtgccggccagcat
ggtgtggccacggcaaccgtatgtgccctgtttggcctgaaatgcgtgatctacatgggt
gctaccgatgtggaacggcaaaagcccaacgtgttccgcatgcgtctgctaggtgcagag
gtggtgcccgttacctctggcgcaggcacgctgaaggacgccatgaacgaggccatgcgt
gattgggtggccaatattgccgatacctacatgcttattggcacagtggcaggcccgcat
ccgtatccggctatggtgcgtgatttccagagcgtgatcggcacggaaaccaaggcccag
atgaaggcagccgaaggccgtctgccagatgtggtggtggcggccattggcggtggttcc
aacgctatggggattttctatccgttcctggatgacaaatctgtgcgtctgattggtgtg
gaagctgctggtcacgggctggatagcggcaaaaccgcagcttctattgaacgtgggcgc
cccggtgtgctgcatggcaaccgcacatatctgcttcagaacgcagatgggcagattgaa
gaagcacactccattagcgccgggttggattaccccggagtagggccggaacattcatgg
ctgcatgatatcggccgcgcagaatacgtaggcattacggataatgaggcactggatgcc
ttccagttctgcacacgtatggaaggtattattcctgcgctggaatccgcccatgctgtg
gcatatgccgccaaaattgcgcctaccctttctaaggatactctgctggtggtcaacctt
tctggccggggtgataaagacatcttcactgttgccgaacatctgggggtcaagctgtga

DBGET integrated database retrieval system