KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_03110Help
Entry
APA03_03110       CDS       T01812                                 

Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
apf00260  Glycine, serine and threonine metabolism
apf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apf01100  Metabolic pathways
apf01110  Biosynthesis of secondary metabolites
apf01130  Biosynthesis of antibiotics
apf01230  Biosynthesis of amino acids
Module
apf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APA03_03110
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APA03_03110
Enzymes [BR:apf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APA03_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAI01514
Position
323568..324887
Genome map
AA seq 439 aa AA seqDB search
MTGDVRLLHIWQARFFTRYGSGRPEMADPKEHGTSAVHSNSLRHQPDERGHFGGRHGGRF
VAETLMPLILELDEAYKVAKADPAFRKELDYYLKDYVGRPSPLWFAQRMTEELGGAKIFL
KREELNHTGSHKLNNVMGQILLARRMGRTRIVAETGAGQHGVATATVCALFGLKCVIYMG
ATDVERQKPNVFRMRLLGAEVVPVTSGAGTLKDAMNEAMRDWVANIADTYMLIGTVAGPH
PYPAMVRDFQSVIGTETKAQMKAAEGRLPDVVVAAIGGGSNAMGIFYPFLDDKSVRLIGV
EAAGHGLDSGKTAASIERGRPGVLHGNRTYLLQNADGQIEEAHSISAGLDYPGVGPEHSW
LHDIGRAEYVGITDNEALDAFQFCTRMEGIIPALESAHAVAYAAKIAPTLSKDTLLVVNL
SGRGDKDIFTVAEHLGVKL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgatgtcaggcttttacatatctggcaggcgcggtttttcacgcggtatggg
agcggcagaccagaaatggcagatccgaaggaacacggcacgtcagcggtgcatagcaat
tccctccggcaccagccggatgagcgggggcattttggtgggcgtcatgggggccgtttt
gtagcggaaacccttatgcccctcattctggaactggatgaggcctataaggtcgccaag
gctgatccggctttccggaaggagctggattattatctgaaagattatgtcggccgcccc
agcccactctggtttgcccagcgcatgacggaagaattgggtggcgctaaaatttttctt
aagcgtgaagaactcaatcatacgggctcacacaagctcaataacgtcatggggcagatt
ttgctggctcggcgtatgggtcgcacccgtattgtggcggaaaccggtgccggccagcat
ggtgtggccacggcaaccgtatgtgccctgtttggcctgaaatgcgtgatctacatgggt
gctaccgatgtggaacggcaaaagcccaacgtgttccgcatgcgtctgctaggtgcagag
gtggtgcccgttacctctggcgcaggcacgctgaaggacgccatgaacgaggccatgcgt
gattgggtggccaatattgccgatacctacatgcttattggcacagtggcaggcccgcat
ccgtatccggctatggtgcgtgatttccagagcgtgatcggcacggaaaccaaggcccag
atgaaggcagccgaaggccgtctgccagatgtggtggtggcggccattggcggtggttcc
aacgctatggggattttctatccgttcctggatgacaaatctgtgcgtctgattggtgtg
gaagctgctggtcacgggctggatagcggcaaaaccgcagcttctattgaacgtgggcgc
cccggtgtgctgcatggcaaccgcacatatctgcttcagaacgcagatgggcagattgaa
gaagcacactccattagcgccgggttggattaccccggagtagggccggaacattcatgg
ctgcatgatatcggccgcgcagaatacgtaggcattacggataatgaggcactggatgcc
ttccagttctgcacacgtatggaaggtattattcctgcgctggaatccgcccatgctgtg
gcatatgccgccaaaattgcgcctaccctttctaaggatactctgctggtggtcaacctt
tctggccggggtgataaagacatcttcactgttgccgaacatctgggggtcaagctgtga

DBGET integrated database retrieval system