KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_06430Help
Entry
APA03_06430       CDS       T01812                                 

Gene name
hppK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    APA03_06430 (hppK)
Enzymes [BR:apf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     APA03_06430 (hppK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669042..669554
Genome map
AA seq 170 aa AA seqDB search
MSEMNTRLVLIAIGANLPHLRLSARQTCEQAVQALKNLPQLEVEAVSRWYESAPVPPSGQ
PPYVNGVVRCRTTLEPLALLDALQGVETRLGRVRSVPNAARTLDLDIISIDNIQLNTERL
ILPHPRATQRAFVLYPLHDVAPEWKDPVTGKGLDTLLKGVAGQEIQPAKE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaatgaataccagattagtgctgatagcgataggtgcgaatcttccgcatttg
cgattaagcgcgcgccagacatgtgaacaagccgtgcaggccttgaaaaacctaccccaa
ttggaggttgaggctgtttctcgctggtatgaaagtgcgcctgtgccaccatctgggcag
cctccttatgtgaatggggttgtgcgttgccgcaccacgctggagcctctggccctgctt
gatgcgcttcaaggggtggaaacgcggttggggcgtgtacgttccgtgccaaatgcagcg
cgcacgcttgatttggatattatttcaatagacaatatacagctaaatacagagcgactt
atattgccgcacccccgcgcaacccagcgcgcttttgtgctgtaccccctgcacgatgtt
gcgccggaatggaaagatcccgtaaccggcaaggggctggataccctgcttaaaggcgtt
gcagggcaggaaatacagcccgcaaaggaataa

DBGET integrated database retrieval system