KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_07610Help
Entry
APA03_07610       CDS       T01812                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    APA03_07610
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APA03_07610
Enzymes [BR:apf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     APA03_07610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(788858..789799)
Genome map
AA seq 313 aa AA seqDB search
MASFPGRHTRHLLGLEGMTPDQIEPLLDLAESYALLNRSRKVPRDVLRGRTLINLFFEDS
TRTRTSFELAGKRLGADVINMSVAQSSVNKGETLLDTAATLNAMRTDLLVVRHSQSGAPA
LLAQKVEASVVNAGDGMHEHPTQALLDALTIRRHLGTLGGLKVAICGDVSHSRVARSNIF
LLTGMGSTVRLVGPPTLVPGAMKQRGVEIFHNMEEGLQDVDVVMMLRLQRERMSSGLIPS
AREYFRFFGLDQRRLQLARKNALVMHPGPMNRGVEIDSLVADSSQSVIQEQVEMGVAVRM
AVLDRLTRSRPAA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctagctttcccggccgccacacccggcatctgctcgggctggaaggcatgacgccc
gaccagatcgagcctttgctggatctggccgaaagctatgccctgcttaaccgctcccgc
aaggtgccgcgcgatgtgctgcgggggcgcacccttatcaacctgttctttgaggacagc
acgcgcacccgcacatctttcgagctggcgggtaagcgtttgggggcggacgttatcaat
atgtccgttgcccaatcctcggtgaacaagggtgaaaccctgctggatacagccgcaacg
cttaacgccatgcggacagacctgctggtggtgcgtcattcccaatccggcgcaccggct
ctgctggcgcaaaaggtggaagccagcgtggtcaacgctggtgacggcatgcacgagcac
cccacacaggccctgctggatgcgctgaccattcgccgccacttaggcacattaggtggg
ctgaaagtggccatttgtggggatgtttcacattcccgcgtggcgcgctccaacatcttc
ctgctgacaggcatgggcagcacggtgcggcttgttggcccgccaacgctggtgcccggc
gccatgaagcagcgtggggtggaaatcttccacaacatggaagaaggcctgcaggatgtg
gacgtggtgatgatgctgcgtttgcagcgtgagcgcatgtcctccggccttatccccagc
gcgcgtgaatatttccgcttttttgggctggatcagcgccggttgcagttagcccgcaag
aatgcgctggttatgcaccccggccccatgaaccgtggggtggaaatagacagtcttgtc
gctgattccagccagagcgtcattcaggaacaggtggaaatgggcgttgccgtgcgcatg
gccgttctggaccgccttacccgcagcaggcccgccgcatga

DBGET integrated database retrieval system