KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_07670Help
Entry
APA03_07670       CDS       T01812                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:apf01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:apf00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:apf00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
798345..799586
Genome map
AA seq 413 aa AA seqDB search
MSVEIKVPTLGESVTTATVAKWLKQPGDAVQADEPIVELETDKVSVEVSAPQAGILGPQA
AKEDQEVEVGALLTTLEPAKAGAAPAAKAAAPEKKAEPVAAAAPAKAAAPAPKAAAPAPA
VDAGAALPAARKMMAENGLSAQQLAGTGLGGRITKGDVLGFLANPQAATPAAAPKPPRND
DPREERVKMTRLRRTIARRLKEAQNTAAMLTTFNEIDMSGAMALRAEYQDSFVKKHGVKL
GYMSIFSRAVVAALKEFPAINAEIDGDDVIYRDFVNLGIAVGGPNGLVVPVIRDADKMSY
AEIEKTIAGFGKAAREGTLKLDQLSGGTFSITNGGIYGSLLSTPILNAPQSGILGMHSIQ
ERPVAVNGQVVIRPMMYIALSYDHRIVDGKEAVSFLVRVKQNVEDPRRLLIEV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgagatcaaggtgccgacactgggtgaaagcgtaaccacagcaaccgtggcc
aagtggctgaagcagccgggcgacgcggtgcaggcagatgaaccgattgttgagctggaa
accgataaggtgagcgtggaagtttctgcgccgcaggctggtattctgggcccacaggct
gccaaggaagaccaggaagtagaagtgggcgcattgctgaccacgctggaacccgccaag
gctggcgctgcaccagccgccaaagccgctgccccggaaaagaaagcagaacccgtagcg
gctgccgctccggcaaaagcagccgcaccagcacctaaggccgcagccccggctccggca
gtagatgccggtgctgctctgcccgcagcccgcaagatgatggctgaaaacggcctgagc
gcacagcagcttgcaggcaccggccttggtggccgcattaccaaaggggatgtgctgggc
tttttggccaacccgcaggctgcaacaccagccgcagcccccaagccgccgcgtaatgat
gacccgcgcgaagaacgcgtgaagatgacgcgcctgcgccgcaccattgcccgccgcctg
aaggaagcacagaacacggcggccatgctgacaacgtttaatgaaatcgacatgtccggc
gccatggcgctgcgtgccgagtatcaggactcgtttgttaaaaagcacggtgtcaagctg
ggctatatgtccatcttctcccgcgctgttgtggctgccctgaaagagttcccggccatt
aacgcagaaattgacggtgatgatgtgatctaccgtgatttcgtaaacctcggcattgcc
gtgggtgggccaaacgggctggtggtgccggttatccgtgatgccgacaagatgagctat
gccgaaattgaaaaaaccattgcaggttttggcaaggcagcgcgtgaaggcacgttgaag
ctggatcagctttctggcggcaccttctccatcaccaatggcggtatttacggttctctg
ctgtccacccccatcctgaatgcacctcagtccggtattctgggcatgcactccattcag
gaacgcccggtggcagtgaacgggcaggtggtgatccgcccgatgatgtatattgccctt
tcttatgatcaccgcattgtagatggcaaggaagccgtcagcttccttgtgcgggtgaag
cagaacgtagaagacccgcgccgccttctgattgaagtctga

DBGET integrated database retrieval system