KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_07980Help
Entry
APA03_07980       CDS       T01812                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:apf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834334..835062
Genome map
AA seq 242 aa AA seqDB search
MHPRGVIVTRPEPGLSETMAAVADTGWLPLASPALVVQRHTLRLPQKLPAAILLTSGQAV
SAAVVAAQQAKALDIPVYAVGDRTAQRARDAGFTHVKSADGDARALVALLQTHQQPECGS
LLLCSGAGQGVELAAWCRQAGFKVVRRVVYAAKPIQHINAQTCTAIQAAKVAVVLFFSAE
SAAGWLAALPEAEQKQLAAQASAVVISGRVAGVLRAAGWQNIRVADHVSAAAVMDALGTY
PA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgcgcggcgtgattgtcacgcgcccggaaccggggctgagtgaaacaatggca
gccgttgcagatacaggctggctgccattggcctcacctgcattggttgtgcagcggcat
acgttgcgcctgccgcaaaaattacccgcagccatattacttaccagtgggcaagctgtt
tctgctgcggttgtagcggcacagcaggccaaagcgctagatataccggtttatgcggta
ggggatcgcacagcccaacgggcgcgagatgccgggtttacgcacgttaaaagtgcggat
ggtgatgcccgtgcgcttgttgcgcttttacaaacccaccaacagccagaatgtggcagc
ctgttgctatgctctggggcagggcaaggcgtagagcttgcggcttggtgcaggcaggcg
gggtttaaggttgtgcgccgggttgtttatgcagccaaaccgatccagcatataaacgct
caaacatgcacagccattcaggctgccaaggtggcggtggttctgtttttttcagcagag
agtgccgctggctggttggccgctttgcctgaggcagaacagaagcagttagctgcgcag
gcaagtgcggtggtgatatctggccgtgtagccggtgtgctgcgtgcggccggttggcag
aacatacgtgttgcagaccatgtatccgccgcagcggttatggatgctttggggacgtat
cccgcataa

DBGET integrated database retrieval system