KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_08030Help
Entry
APA03_08030       CDS       T01812                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Brite
Enzymes [BR:apf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     APA03_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
838097..839524
Genome map
AA seq 475 aa AA seqDB search
MKRLIVSAVGAALLAYGGTVAYLQHFDHITAPELPASSPTLKDPVALAAFNALREARCDY
CHAEQRDLPFYFRVPVAKTLMEKDRANGLRHFRVEPVLDAFEQGTVPTEEQLSRIEEVIT
QNRMPPNLYLMMHWHAHLSNAEREAVLKWVQDTRRKNYNNTGAAEQFAAEPIRPVPESVE
ADPAKWTLGRKLFFDKSLSGDNTLNCASCHGLDTGGVDNLVTATGIGGQKGPINTPTVYD
AYFKMAQFWNARATTLAEQAAGPVMNPVEMGSHNWEEVANKLNANPEYAPLFQAAFGPDA
KVDEKTITTAIGEFEKTLATPNGAFDEYLKGKPDAISEQAKRGYERFKAIGCSGCHTGIG
VGGRGMEIMGLEGDYFKDRGGKLTDADQGRYAVTHEASDMNRFVVPNLRNIELTGPYFHD
GSVKTLDEAVRKMARYQTPDQNISDQDVADIVAFLKTLTGRYDGKLLTNSNPAAK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgattaatcgtgtcagcagtgggtgcagctctgctggcttatggtggaacagtc
gcttacctgcagcattttgaccatattacagcaccagaattaccagcatcttcccccacg
ctgaaagatcctgtggcactggcagcgtttaacgccctgcgtgaggcacggtgtgattac
tgccatgccgaacagcgtgatctgccattttacttccgtgtgccggttgccaaaacgctt
atggaaaaagaccgcgccaacgggctgcgtcatttccgtgtagagccggtgctggatgcg
tttgaacagggtacagtccctacggaagagcagctttcccgcattgaggaagtgattacg
caaaaccgtatgccgccaaacctgtatctgatgatgcactggcacgcccatctgtctaac
gcagagcgtgaagccgtgttgaaatgggtgcaggatacgcgccgcaaaaactacaacaac
accggtgcggcagagcagtttgcagcagagcctattcgccctgtgccagaaagcgtggaa
gcagacccggctaaatggacgctggggcgcaagctgttctttgataagagcctgtcgggc
gataacacgcttaactgcgcaagctgccacgggctggataccggcggggtggataatctg
gttacagccaccggtattggtgggcagaaaggccccatcaacacgcctacagtgtatgat
gcctacttcaagatggcgcagttctggaatgcccgtgccaccacgctggcagaacaggcc
gctggccctgtgatgaacccggtggaaatgggttctcataactgggaggaagtggccaac
aagctgaatgccaacccggaatacgcaccgctgttccaggctgcatttggcccagatgcc
aaggttgatgaaaaaaccattaccacggctattggcgagtttgaaaaaacgctggctacg
ccaaatggcgcttttgatgaatacctcaaaggcaagccggatgccattagtgagcaggcc
aaacgcgggtatgaacgctttaaggccattggttgttcaggttgccataccggcattggt
gtgggtggacgcggcatggaaatcatgggtcttgaaggcgattactttaaagaccgtggt
ggcaagctgacggacgctgatcaaggccgttatgcggtaacgcatgaagcgagtgacatg
aaccgctttgtggtgcccaacctgcgtaatattgagctgacaggcccatacttccacgat
ggcagcgtaaaaacgctggatgaggctgtgcgcaaaatggcccgttaccaaaccccggat
cagaacatctctgatcaggatgtggcggacattgtggccttcctgaaaacgctgacaggg
cgttacgatggcaagttgctgaccaacagcaatccggccgccaaatag

DBGET integrated database retrieval system