KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_11890Help
Entry
APA03_11890       CDS       T01812                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    APA03_11890
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    APA03_11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1248252..1248770
Genome map
AA seq 172 aa AA seqDB search
MDGRFLNRIAVSAVLSAAVLATCVFAARSTVPDTAPARPAFSLPGLEPVPIAPLMAQANV
QRGGATVRQVCAQCHALAGGAAENAGPPLAGVAGRGVASCTGYTYSAALRQHAGQHWTDQ
MLADWLMAPARFAPGTRMSLTGIPDPAQRADVIAFLHTLGGQAAPAQAGCTP
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggatggcaggtttctgaacagaatagcggtttccgccgtgcttagtgcggcagtgctg
gcaacatgtgtgtttgctgcacgcagcaccgtgccagatacagcccctgcccgccctgct
ttttctttgccggggttggagcccgtacctattgctccgttaatggcgcaggccaatgtg
cagcgtggtggtgcaaccgtcaggcaggtttgcgcgcagtgccacgccttggctggtggg
gccgcggaaaacgccgggccgccgctagccggtgttgctgggcgtggtgtggcatcatgc
actggctacacctattctgcggcgttacggcagcatgcaggccagcattggacagaccag
atgctagcggattggcttatggcccctgcccgctttgcacccggcacacgtatgtctctc
actggtataccagatcccgcccaacgggcggatgttattgcatttcttcacactctcggc
gggcaggctgcgcccgcacaggcaggatgcacaccatga

DBGET integrated database retrieval system