KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_12160Help
Entry
APA03_12160       CDS       T01812                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
apf00010  Glycolysis / Gluconeogenesis
apf00020  Citrate cycle (TCA cycle)
apf00620  Pyruvate metabolism
apf01100  Metabolic pathways
apf01110  Biosynthesis of secondary metabolites
apf01120  Microbial metabolism in diverse environments
apf01130  Biosynthesis of antibiotics
apf01200  Carbon metabolism
Module
apf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA03_12160
   00020 Citrate cycle (TCA cycle)
    APA03_12160
   00620 Pyruvate metabolism
    APA03_12160
Enzymes [BR:apf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APA03_12160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: BAI02416
Position
complement(1272710..1273954)
Genome map
AA seq 414 aa AA seqDB search
MATEILMPALSPTMTEGKLARWLKKEGDTVNSGDVLAEIETDKATMEVEAIEEGILGRIL
IQEGAEGVAVNTPIAILVEEGEAVPDNIDTPKNVASAEPAPVPQPVASAPVAAQAAPAQR
ADKPVGRVVASPLARRIARQKNIDLAAIKGTGPNGRIVKRDVEAALNKAPSAGQVASALP
ASGGSSAVPHTTMRKVIARRLSESKATIPHFYVSIDVELDALLALRAQLNAMSPAEGADA
FKLSVNDMLIKASAVALKQVPEVNASYTEDAMILHEDADISVAVSLDDGLITPIVKQADR
KSLKDISQEAKDLIARARAGKLKPEEFQGGTFSISNMGMYGVKDFAAIVNPPQAAILAIA
AGKKQAVVKGNELAIATVMTVTLSVDHRVVDGAAAARWLSAFRTAVESPLSLVL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaaattttaatgcccgccctttctcctaccatgacagagggcaaactggcc
cgctggctgaaaaaggaaggggacaccgtaaacagcggtgatgttctggccgagattgaa
accgacaaagccacaatggaagtagaagccattgaggaaggtattctgggccgcatcctt
attcaggaaggcgcagaaggtgttgctgtcaacacacctatcgccattctggtggaagaa
ggtgaggcggtgccagataacatcgacacgcctaaaaacgtggcgtctgctgagccagcc
cctgtgccgcaacctgttgcttctgcaccagtagcagcacaggccgcacctgcacagcgg
gcagataagcctgttggccgggttgtggcctctccacttgcgcggcgcattgcacgccag
aagaatattgatctggcagccattaaaggcactggcccaaatggccgtattgttaaacgg
gatgtggaagccgctcttaacaaagccccaagtgcagggcaggtggcttctgccttgcca
gcatctggtggcagcagtgcggtgccgcacaccactatgcgtaaggttattgcacgccgc
ctgagtgaatccaaagccaccattccgcacttctatgtctccatagatgtagaactggat
gcactactggctttgcgtgcgcagcttaatgccatgtctcccgcagaaggggctgatgcc
ttcaagctgtctgtaaacgatatgctcattaaggcttctgccgttgcccttaagcaggtg
ccggaagtgaacgcgtcttacaccgaagatgccatgatcctgcacgaagatgcagatatc
tcggttgcggtttctctggatgatgggctgatcacgcctatcgtcaaacaggcagaccgc
aagagcctgaaagatatcagtcaggaagccaaggatctgattgcccgcgcccgcgctggc
aagctgaagccggaagaattccagggtggtacgttctccatttccaatatggggatgtac
ggcgtgaaagactttgccgccattgttaacccgccgcaggctgccattctggctattgca
gcaggtaaaaaacaggctgtggtaaaagggaatgaactggctattgctacagtcatgacc
gttaccctctcggtggatcaccgtgtggtggatggtgcggcggctgcgcgttggctttct
gctttccgtacagcggttgaatctccgctttcactcgttctctaa

DBGET integrated database retrieval system