KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_12250Help
Entry
APA03_12250       CDS       T01812                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APA03_12250
   01230 Biosynthesis of amino acids
    APA03_12250
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA03_12250
   00051 Fructose and mannose metabolism
    APA03_12250
   00562 Inositol phosphate metabolism
    APA03_12250
Enzymes [BR:apf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     APA03_12250
Exosome [BR:apf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   APA03_12250
  Exosomal proteins of bladder cancer cells
   APA03_12250
  Exosomal proteins of melanoma cells
   APA03_12250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1283302..1284042
Genome map
AA seq 246 aa AA seqDB search
MTRQIIVGNWKMNGLSRDSQELVKAITSGLPANSADVVVCPPFTQLGLLTDMLKPTPVKL
GAQDCHQEVSGAHTGDISAPMLADLGVSYVVLGHSERRQEHGELDETVREKAMAAAKAGL
TPIVCIGETEDQRETGEHFDALGWQIKGSLPDGFNGILAYEPIWAIGTGLAATTDQIAET
MKFLREELVRQFGEAGKVIKILYGGSVNAGNAATILPIPEVAGALVGGASLKADAFLSIV
SAASAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacagattattgtcggcaactggaaaatgaatggcctaagccgtgattcgcag
gaactcgtcaaggctattaccagcggcctgcccgccaacagtgcggatgttgtggtgtgc
ccgccctttacccagcttgggctgctgacagatatgctcaaacccacacccgtaaaactg
ggagcacaggattgccatcaggaagtttctggcgcgcatacgggtgatatttctgccccc
atgctggccgatctgggtgtgtcctacgttgttctgggccattcagaacgccgtcaggaa
cacggtgagctggatgaaacggtgcgtgaaaaagccatggctgctgccaaagccgggcta
acccctattgtctgtattggtgaaacagaagatcagcgcgaaaccggtgagcactttgat
gcgctgggttggcagatcaagggttccctgcccgatggttttaacggtattctggcgtac
gagcccatctgggccattggtacgggccttgctgccaccaccgatcagatagccgaaacc
atgaaattcctgcgtgaagaattggtgcggcagtttggagaggctggaaaagtcatcaaa
atcctgtatggagggtccgtaaacgccgggaatgcggccaccatcctgcccattcctgaa
gtggcgggtgcgcttgttggcggcgccagccttaaggcggacgcgtttctttccatcgtc
agtgcagcatctgctgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system