KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_17360Help
Entry
APA03_17360       CDS       T01812                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APA03_17360
Enzymes [BR:apf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     APA03_17360
Peptidases [BR:apf01002]
 Cysteine Peptidases
  Family C44
   APA03_17360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1876532..1878292
Genome map
AA seq 586 aa AA seqDB search
MCGIGGLIYTPGTQPCSESVLERMAQALGHRGPNGVHIARLGRADMVHTRLAIIDLEGGD
QPLTSGDGTLVANGEIYNDPQIRRQIGPEHFQTGSDCESPLLLWERNGCTYTRGLRGMYA
IGLYDKAQQELLLSRDPFGIKPLYFTEFSGGIAFASEPAPLIASGLAPRAIAPAVRDELL
QLQFTTGWETIFPGIQRVMPGETLRINQGRILDRQRQSPIPAHAPFFTSEAEALNHLDAA
LMDSVHAHERSDVPFGLFLSGGIDSACLLTAMSRLPRTTPLRTWTAIFDAPGAADEAEAA
NALAQHARAKHETLRITADMVWQHLPAIVACMDDPVADYAIIPTWFLAQKAAQDVTVILS
GEGGDELFCGYGRYRSASRPWWKGKRRMWRRGIFDNMNILRQHPAHWRDGIAAAEMAAAD
AATPLSRLQAVDIAEWLPNDLLIKLDRCLMAHGLEGRTPLLDPVVAQTAWSLPDSMRLRD
GKGKWLLRKWLQQHNSAARPFAPKQGFTVPIGIWIRQQGAHLGDLVAQQECIAEIARPDR
VKALFRAADNRRTGAAAWALLFYALWHRTHIRNLPPEGDVFSALSQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcattggggggctgatttatacgcccggcacgcagccatgttccgaatcggtt
ctggaacgtatggcgcaggccttgggccatcgtggccccaatggtgtgcatattgcccgg
ttgggccgtgccgatatggtgcatacacgccttgccattattgatctggaaggtggagac
caacccttaaccagtggcgatggcacgcttgttgccaatggtgagatctataacgacccg
caaattcgccgacagatcgggccagagcatttccagaccggaagtgattgtgaatctccc
ctgcttttgtgggagcgtaacggctgcacctatacccgcgggctgcgcggcatgtatgcc
attggcctgtatgataaagcccaacaggaacttttgctctcgcgcgatccgtttgggatc
aaacctctttattttaccgaattttcaggcggcattgcctttgcatccgaacccgcgcct
ttaatcgcctctggtcttgccccccgcgccattgcgcctgctgtgcgcgatgaactgctg
caactgcagttcaccacagggtgggaaacaatttttcccggtattcagcgcgtcatgccg
ggggaaaccctgcgcatcaaccaagggcgtattctggacaggcaacggcaatcccccatt
ccggcccacgctccttttttcacttctgaagctgaggccctgaaccatcttgatgctgcc
ttgatggacagcgtgcatgcgcatgaacgttctgatgtgccatttgggctgttcctttct
ggcggcatagatagtgcctgcctgttaacagccatgagccgcctgccccgcaccacgccc
ttgcgcacatggaccgccatttttgatgcccccggtgctgcggatgaagcagaagctgcc
aatgccttagcccaacatgcccgcgccaaacatgaaaccttgcgcattaccgcagatatg
gtgtggcagcacctgccagccattgtggcctgtatggatgatccggttgcagattacgcc
attattcccacatggtttttggcccaaaaagcagcacaggatgtaaccgttattctctct
ggcgaagggggagatgaactgttttgtggctatgggcgttatcgctctgccagccgcccg
tggtggaaaggcaagcggcgtatgtggcggcgcggtatttttgacaacatgaatattctg
cgccagcacccagcccattggcgggatggcatagccgctgcagaaatggccgctgcagat
gccgcaacgccactttcacgcctgcaagctgtagatattgcggaatggttgccaaatgat
ctgcttatcaagctggatcgatgcctgatggcacacgggctggaaggccgcacaccgttg
ctagaccccgttgtggcccaaacagcatggagcctgcccgattccatgcgcctgcgtgat
ggcaagggaaaatggcttttgcgcaaatggttgcagcaacacaattctgccgcacgcccc
tttgcccccaagcaaggctttaccgtaccgattggcatatggatcagacagcaaggtgct
catcttggtgacttggtggcgcagcaggaatgtattgcagaaattgcccgcccagaccgt
gtaaaagccctgtttcgcgcagcagataaccgcagaacgggtgcagccgcatgggcactt
ttattttatgctctgtggcatcgcacacatattcgcaatcttccgccagaaggcgatgtg
ttttctgccttaagccagtaa

DBGET integrated database retrieval system