KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_19380Help
Entry
APA03_19380       CDS       T01812                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APA03_19380
Enzymes [BR:apf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     APA03_19380
Exosome [BR:apf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APA03_19380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2115363..2116367
Genome map
AA seq 334 aa AA seqDB search
MMAGRFPLARPRRNRIDDFTRRLVAENTLGINNLIWPIFFMEGTNTITEVSSMPGVHRVT
LDKLAAHVEPAAKLGIPALALFPITPTEARDEKGTEATNPDNLMCRAARLLKKEFPEVGL
IGDVALDPYTSHGHDGLIENGYVVNDPSVTILSQQAVNQAAAGVDIIAPSDMMDGRIEAI
RRDLDGNGLINTRIMSYAAKYASAFYGPFRDALGSGGMLKGDKKTYQMDPANSDEALREV
EMDIAEGADMVMVKPGLPYLDIIRRVKDEFHVPTFAYQVSGEYAMLMAAIRNGWLDHERA
VMESLLAFRRAGANGILTYFAIEAAERIRASFGQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatggctggccgttttcctctggctcgcccccggcgcaaccggattgatgatttcacg
cgccgtttggttgctgaaaatacgttgggcatcaacaatctgatctggcctatctttttt
atggaaggcaccaacacgattaccgaggtgtcctccatgcccggcgtacaccgtgttacg
ctggacaagctggccgcacatgttgagcccgccgcaaagctgggtattccagctttggcc
ctgtttcccatcacgcccacagaagcgcgagatgaaaaaggcacggaagccacaaacccg
gacaacctgatgtgccgggccgcccgcctacttaaaaaggaatttccggaagttgggctg
attggtgacgtggcgctagacccctataccagccacggccacgatggcctgattgaaaat
ggctacgtggtgaatgatccatccgtaaccattctttctcagcaggccgttaatcaggct
gctgctggtgtggacattattgccccgtcagacatgatggatggccgtattgaagctatt
cggcgtgatctggacggcaatgggctgatcaacacccgtatcatgtcctacgctgccaag
tatgccagcgccttttatggcccgttccgtgatgctctgggttctggcggcatgctgaaa
ggtgataaaaaaacctatcagatggacccagccaacagcgatgaagccctgcgcgaagtg
gaaatggacattgctgaaggcgcagacatggttatggtcaaacccggcctgccatatctg
gatatcatccgccgtgtgaaggatgaattccacgtacctacctttgcctatcaggtatct
ggtgaatatgcgatgctgatggcggccatccgcaatggctggctggaccatgaacgcgcc
gttatggaaagccttctggccttccgccgcgctggcgccaatggcattttaacgtatttt
gctattgaagctgcagaacgtatccgggcatctttcggccaatag

DBGET integrated database retrieval system