KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_20810Help
Entry
APA03_20810       CDS       T01812                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APA03_20810
Enzymes [BR:apf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     APA03_20810
Exosome [BR:apf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APA03_20810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2264351..2266579)
Genome map
AA seq 742 aa AA seqDB search
MPARSVSKNRKMADLVLQKQIEELASGHSSNPFAVLGRHPDGRGDIVRVFFPDAFEVRVV
ITSADGSTLERQMQRIHPHGVYSVTIPKRSQSYFVRVKWADSWQDVVDPYSFGKLLGDLD
LHLFSEGRHQSPDAIMGAHCVEIHGVKGVRFTVWAPNARRVSVIGDFNIWDGRRHPMRLR
HGAGVWELFVPGLIAGERYKYEILSAEGKVLPAKADPYARFTEKPPATASRVAAPIIHEW
HDADWMAQRHEFHKVNAPLSIYEIHAPSWRSPESGQGFVSWGGLADALIPYIQELGFTHI
ELLPITEYPFSGSWGYQPVSMYAPTARHGEPQEFAAFVDRCHQAGIGVIMDWVPAHFPSD
PHGLACFDGTHLYEHADPQEGFHQDWHTLIYNFGRNEVRGFLLGSAFYWLKHFHIDGLRV
DAVASMLYRDYSRKEGEWKPNIYGGCENLEAVSFFHELSALMRDMYDDVMLIAEESTAWP
GVTMPSEAGGLGFRFKWNMGWLHDTLRYMQRNPLWRGYHANDLSFGMIYAYSERFILPLS
HDEVVHGKGSLLSRMPGDEWQKHANLRSLYALMWAYSGKQLLFMGGELAQWEEWNHDGQI
AWHRLDEASGKGVYNTVVALNRLYRSYPALYAEDYNPRGFQWVIADDAQNCVFAWLHYAP
DAAPVLVVCNMTPVPRHNYRVGVPQGGYWHEILNTDAACFGGSNVGNAGGLHAQDVPAHG
MCCSLDATLPPLAVLYFSPVAP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctcgttctgtatctaaaaatcgtaaaatggctgatttagtgcttcaaaagcaa
attgaagagcttgcatcagggcatagctctaatccttttgctgtgttgggccgccaccct
gatgggcggggtgacattgtgcgtgtctttttccccgatgcgtttgaagtccgggtagtc
attacttcagcagatggatctacgcttgagcggcagatgcagcgtattcatcctcatggc
gtgtatagcgttaccatccccaagcgcagtcaaagttattttgtgcgcgtgaagtgggct
gatagttggcaagatgttgttgacccgtacagctttggcaaactgttgggagatctagac
ctacatctgttttcagaaggacgtcatcagtccccagatgcaataatgggagcgcattgt
gttgagatacatggcgtaaaaggtgtgcgctttacggtttgggcgcctaatgctcgcagg
gtgtctgttattggggatttcaatatatgggatggcagacgtcatcccatgcggttgcgg
catggagccggagtgtgggagttgtttgttcccggccttatagctggggaacgttataaa
tatgaaattctttctgctgaaggaaaagttttgccggcaaaggcagatccttatgctcgg
tttacggaaaagcctccagccacggcatcacgtgttgctgcaccaataatccatgaatgg
catgatgcagattggatggcgcaacggcatgaatttcataaagtgaatgcgccgttatct
atttatgaaattcatgccccttcttggagatcgccagaaagcggccaagggtttgtgtct
tggggtggtttggccgatgcactcatcccttatatccaggaacttgggtttacccatata
gaacttcttccgattacagaatatccgttttctggatcatgggggtatcaacccgtcagt
atgtatgccccaacggctcgccatggggagccgcaggagtttgctgcatttgtagatagg
tgccatcaggctggtattggggtgattatggattgggtgccagctcattttccttctgat
ccgcacgggcttgcatgttttgatggtacacatctgtacgaacatgcagacccacaggag
ggatttcaccaggattggcacacgcttatttataattttggccggaatgaggtgcggggt
ttcctgctgggaagtgccttttattggctgaagcactttcatattgatggtctgcgggtc
gatgccgtggcgtccatgttgtatcgggattacagccgaaaggaaggggagtggaaacct
aatatttacggtggatgtgaaaatcttgaagctgtctcattttttcatgaactctctgcc
ctcatgcgagatatgtatgatgatgtgatgctgatagctgaagagtccacggcatggccg
ggtgtgaccatgccttctgaagcaggcgggttagggtttcgttttaagtggaatatgggg
tggttgcatgacactttgcgttacatgcagcggaatccactttggcgcgggtatcatgca
aatgatctgagcttcggcatgatctatgcctattctgagcgttttattctaccactttct
catgatgaagttgtgcatggcaaaggttctctcttgtcgcgcatgccaggcgatgagtgg
cagaaacatgctaatttacgatctctctacgcgcttatgtgggcatattcaggcaagcaa
ctcctttttatgggaggcgagttagcgcaatgggaagaatggaaccacgatggccagatt
gcctggcacaggctggatgaggcatccggcaagggggtgtataatacggttgtagccctc
aatcgcctctatcgttcttatccggctctatatgcggaggattacaatcctcgtggcttt
cagtgggtgattgcggacgatgcgcaaaattgtgtttttgcctggttacactatgcgcca
gacgcggcacctgttctggttgtttgtaatatgacacctgtgccccgccacaattatcgg
gtgggtgttccacagggtggatactggcacgaaattctcaataccgatgccgcatgtttt
ggtgggtctaatgttggcaatgctggtggtctgcatgcgcaggatgtgcctgcccacggg
atgtgttgttctttagatgcaacgctcccaccacttgctgttttgtatttcagtccggtt
gctccctag

  All links  
No link information was found.   
DBGET integrated database retrieval system