KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_25920Help
Entry
APA03_25920       CDS       T01812                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:apf00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:apf00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2805591..2806163
Genome map
AA seq 190 aa AA seqDB search
MKSERLAIPDVILITPPRFGDNRGFFSETYNIERMREAGITEPFVQDNQSLSRQKGVIRG
LHCQLDPFAQGKLVRCTRGAIWDVAVDARTGSPTYGKWVAAELSEENWSQLWIPPGFLHG
FCTLTENAEVQYKCTALYSKASERAVIWNSAELGIDWPVKAEDAVLSEKDLLAPEFSAAK
GWFQYVGKEG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgaacgccttgccattcccgatgttattctgattacgccaccacgctttggt
gacaatcgtgggttcttttcagaaacctacaatatcgaacgcatgcgcgaagctggcatt
acggaacctttcgtgcaggataaccagagtctttcccgccagaaaggtgttatccgcggc
ctgcattgtcagcttgatccgtttgcacagggcaaattagtgcgctgcacacgtggggct
atctgggatgttgccgtagatgcccgcacaggctcccctacttatggaaagtgggttgcg
gccgaactgtccgaagaaaattggtctcagctctggattccgccgggcttcctgcacggc
ttctgcaccctgactgagaatgcagaagtgcaatacaaatgcacggctctttacagcaaa
gcatctgaacgcgccgttatctggaacagtgcggaactcggcatagattggcccgttaag
gccgaggacgccgtattgtctgaaaaagacttgctggcaccggaattttcagctgccaaa
gggtggttccagtatgtagggaaagaaggctga

DBGET integrated database retrieval system