KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_00320Help
Entry
APA12_00320       CDS       T01814                                 

Definition
succinate dehydrogenase membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APA12_00320
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA12_00320
   00650 Butanoate metabolism
    APA12_00320
  Energy metabolism
   00190 Oxidative phosphorylation
    APA12_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29110..29523
Genome map
AA seq 137 aa AA seqDB search
MNASAPHIEVMRSQLGRARGLGAGHSGVGHWWAERVTAASLLPLSTWFVVQMFRLGGADH
TEVVKWGGKPVNATMLIALIITTFYHAQLGLQVIVDDYVHGKAHLPTRLLVKIGTSLLGL
LGVIAVIKLFVRGSTAK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttctgctcctcatattgaagtcatgcgctcccagcttgggcgggcacgcggg
ctcggggccgggcattccggtgtaggccattggtgggccgaacgtgtaacggcagcttcc
ttgcttccactttcaacgtggtttgtggtgcagatgttccgccttggcggcgcagatcat
acagaagtggtgaagtggggcggcaagcccgtaaacgcgaccatgctgatcgccctgatc
atcaccactttctaccatgctcagcttgggctgcaggtcattgtggatgattacgtgcac
ggcaaggcgcatctgcctacccgcttgcttgttaaaatcggtacctccttgttggggctg
ctgggcgtaattgccgttatcaagctgtttgtgcgcggtagcactgccaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system