KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_00540Help
Entry
APA12_00540       CDS       T01814                                 

Gene name
recR
Definition
DNA recombinase RecR
Orthology
K06187  
recombination protein RecR
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APA12_00540 (recR)
DNA repair and recombination proteins [BR:apg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      APA12_00540 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54407..55003
Genome map
AA seq 198 aa AA seqDB search
MGGQEIEQLIRLLGRLPGFGPRSARRVALYLLKEPQTRLAPLAHAMERAGNAIKTCSSCG
NLDTIDPCHICSDPLRDQGLICVVETVGDLWALERAGVHRGVYQVLGGTLSPLAGIGPED
LDVAPLFEKLNKGTVREIILALGATVEGATTMHWLMDQLAPYGGVTVSRVAQGVPMGGAL
DVLDDGTLAAALGARRPA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggcaggaaatagagcagcttatccggcttttgggccggttgccggggtttggc
ccgcgttctgcgcgcagggttgcgctgtatttgctgaaagaaccgcaaacccggcttgcg
cctctggcgcacgcaatggagcgggcaggcaatgccataaaaacctgctcatcctgcggt
aatctggatacgatagatccatgccatatctgctctgatcctttgcgagatcagggtttg
atctgtgttgtggaaacggtgggtgatctgtgggcgctggagcgtgctggtgtgcatcgt
ggagtgtatcaggttttaggcggcacactctctccgttggcgggtattgggccggaagat
ctggacgtagccccgctgtttgaaaagctgaacaaaggcacagtgcgcgaaattattctg
gcattaggcgcaacggtagaaggggccaccaccatgcattggctgatggatcagcttgcg
ccttatggtggtgtaaccgtcagccgtgttgcgcaaggcgtgcccatgggtggggcgctg
gatgtgctggatgatggcactctggccgcagcgctaggcgcacggcgccctgcatga

DBGET integrated database retrieval system