KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_02300Help
Entry
APA12_02300       CDS       T01814                                 

Gene name
ttg2C
Definition
toluene transporter substrate-binding periplasmic protein Ttg2C
Orthology
K02067  
putative ABC transport system substrate-binding protein
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Module
Putative ABC transport system
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243572..244117
Genome map
AA seq 181 aa AA seqDB search
MRLMASAMAEKSRRSLTELLTGTFVLVAIGGMLVAAVVGEGRKTDTTGYQLNADFTHIDG
LDIGSDVRLAGVTVGQVVRETVDPHTFKAHVTFTVRPDIHLSDDTAAIITSDSLLGGKYI
ALSPGGDDKTLKPGETVGQTQGSISLEQLLSKFIFSVTDTLTRANKAAPANGGGTGGNDL
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttatggcttcagcaatggcagaaaaatctcggcgtagtcttacagaactgctt
acaggcacttttgtgttggtggctatcggcggcatgctggtggctgccgtggtgggcgaa
ggccgcaagacagacacaaccggttaccagcttaatgccgatttcacgcacatagatggg
ctggatattggctctgacgtgcggctggctggggtaacagtcgggcaggtggtgcgtgaa
acggtagacccacacacctttaaggcacatgtcactttcactgtgcgccccgatattcat
ctttcagatgatacggcagctattatcaccagtgatagcctgctgggcggcaagtatatt
gccctctcccccggtggggatgacaaaactctcaaacccggtgagacagttgggcagaca
cagggctccatcagcctggagcagttgcttagcaaattcattttctcggttacggatacc
ctcacacgtgccaacaaggcagcacctgcaaatggtggtggcacgggcgggaatgatctg
ccctga

DBGET integrated database retrieval system