KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_03120Help
Entry
APA12_03120       CDS       T01814                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APA12_03120
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APA12_03120
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APA12_03120
Enzymes [BR:apg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APA12_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
324884..325717
Genome map
AA seq 277 aa AA seqDB search
MSRIAARFKALAAQGRGALIPYLEAYDPDWDTSLELLRKMPAAGADLIEIGMPFSDPSAD
GPVIQAAARRGLKAGATLAGVLDMVTDFRQQDNETPIILMGYLNPVESYGYERFCRDAAS
AGVDGLILVDLPPEEADVLAPFAKANKLDIIRLVAPTTSDERLPYVLSHASGFVYYVSIT
GITGTRSATTHDLEAAIPRLRKVTKLPIAIGFGVRTPQQAANASSIADGAVVASALLSTL
AETLDDKGRATAETLPRVLAQIEDLAKAVRSANGKAV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtatagcagcccgttttaaagcacttgcggcccaaggccgcggcgcgcttatt
ccgtatctggaagcatatgatccggattgggatacatcgctcgaactgctacgcaaaatg
cccgctgctggcgcagatctgattgaaattggcatgcctttttcagatccctccgccgat
ggcccggttattcaggctgctgcccgccgtggccttaaagccggggccacgctggcaggt
gtgctggatatggtcacggacttccgccagcaggataacgaaacccccattatccttatg
ggctatctaaatccggtagaatcctatgggtatgaacgcttctgccgtgatgccgccagc
gctggtgtggacgggctgattctggtggatctgccgccagaggaagccgatgtgctggca
ccatttgccaaggccaacaagctggatatcatccggcttgtggcgcctaccacgtcggat
gaacgcctgccttatgtgctctctcacgcatctggctttgtgtattatgtcagcattacg
ggcattacgggcacacgttctgccactacgcatgatctggaagccgctattccacgtctg
cgtaaggttaccaaattgccgattgctattgggtttggtgtgcgtacgccgcaacaggcc
gccaatgcttccagcattgccgatggtgcagtcgtggcttcggccctgctttctactttg
gcggaaacgctggatgacaaaggccgcgctacggcagaaacgcttccgcgcgtgttggcg
cagattgaagatctggcaaaagccgtgcgtagcgctaacggaaaggcggtatga

DBGET integrated database retrieval system