KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_06880Help
Entry
APA12_06880       CDS       T01814                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:apg00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708905..709558
Genome map
AA seq 217 aa AA seqDB search
MAHNAQGNHNGAERRRGVCLVISAPSGAGKSTIANALRASEPVLKHSVSVTTRQPRPGEK
EGVHYHFRTMEDFERMAANGELLEWATVFGRGYGTPRAPVEAALAAGHDMVFDIDWQGHQ
QIRRALPDDVVSLFVLPPSLEELERRLRGRASDHPDEIARRMAAARDEISHWREFDHVII
NTDLDRAITEARAVLTAARLQTRRRTGLLDFVASFGA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacaacgcacagggtaaccataacggagcagaacggcggcgcggtgtgtgcctg
gttatttctgcgccatccggggcgggtaagtccaccattgccaatgcactgcgtgcttcc
gagcctgtgctcaagcactcggtttccgtgaccacgcgccagccaaggccgggggaaaag
gaaggcgtgcattatcacttccgtaccatggaagattttgagcgcatggccgcaaatggt
gagttgctggaatgggccaccgtgtttgggcgtggttacggcacaccccgcgccccggtg
gaggctgccttggctgccgggcacgatatggtgtttgacatagactggcagggccaccag
caaattcgccgtgcactgcccgatgatgtggtgagcctgtttgtgctgccgccatcattg
gaggaactggaacgccgcctgcgtggccgtgcatcagaccaccccgatgaaattgcccgg
cgcatggccgccgcacgggatgaaatctcgcattggcgggaatttgaccacgtgattatc
aatacggatctggaccgcgccattacggaagcccgcgcggtgctaacggcggcacgcctg
caaacccgtcggcgcacggggctgttggattttgttgccagttttggagcctga

DBGET integrated database retrieval system